Thbs1 (thrombospondin 1) - Rat Genome Database

Name: Thbs1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Thbs1 (thrombospondin 1) Rattus norvegicus

Analyze

Symbol:

Thbs1

Name:

thrombospondin 1

RGD ID:

1588455

Description:

Enables transforming growth factor beta binding activity. Involved in several processes, including cellular response to tumor necrosis factor; positive regulation of transforming growth factor beta production; and response to testosterone. Located in extracellular space. Biomarker of diabetic retinopathy; heart disease; myocardial infarction; and prostate cancer. Human ortholog(s) of this gene implicated in cholangiocarcinoma; pancreatic cancer; and pancreatic ductal carcinoma. Orthologous to human THBS1 (thrombospondin 1); PARTICIPATES IN syndecan signaling pathway; cell-extracellular matrix signaling pathway; malaria pathway; INTERACTS WITH (S)-colchicine; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

thrombospondin-1; TSP-1; Tsp1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	THBS1 (thrombospondin 1)	RGD	RGD
Mus musculus (house mouse):	Thbs1 (thrombospondin 1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Thbs1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	THBS1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	THBS1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Thbs1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	THBS1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	THBS1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Thbs1 (thrombospondin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	THBS1 (thrombospondin 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Thbs1 (thrombospondin 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	thbs1a (thrombospondin 1a)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	thbs1b (thrombospondin 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	thbs1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	105,056,293 - 105,071,445 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	105,056,292 - 105,071,440 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	108,721,861 - 108,736,913 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	117,317,382 - 117,332,433 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	114,977,769 - 114,992,820 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	109,862,120 - 109,873,466 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	109,862,117 - 109,873,466 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	116,411,045 - 116,422,101 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	3	103,978,436 - 103,990,486 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

Bloom syndrome (ISO)

Breast Neoplasms (ISO)

Cerebral Hemorrhage (IEP)

Chemical and Drug Induced Liver Injury (ISO)

cholangiocarcinoma (ISO)

colorectal cancer (ISO)

COVID-19 (ISO)

diabetic angiopathy (ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (IEP,ISO)

Experimental Diabetes Mellitus (IMP)

Experimental Mammary Neoplasms (IEP)

Fibrosis (ISO)

Gallbladder Neoplasms (ISO)

genetic disease (ISO)

heart disease (IEP)

hepatic veno-occlusive disease (ISO)

interstitial nephritis (ISO)

juvenile rheumatoid arthritis (ISO)

liver cirrhosis (ISO)

myocardial infarction (IEP)

Myocardial Reperfusion Injury (IEP)

obesity (ISO)

pancreatic cancer (ISO)

pancreatic ductal carcinoma (ISO)

primary ovarian insufficiency (ISO)

prostate cancer (IEP)

Reperfusion Injury (ISO)

schizophrenia (ISO)

Sjogren's syndrome (ISS)

Spinal Cord Injuries (IEP)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-colchicine (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrobenzenesulfonic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-Nitrobenzanthrone (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (ISO)

6alpha-methylprednisolone (ISO)

9-cis-retinoic acid (ISO)

acetylsalicylic acid (ISO)

ADP (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucose (EXP,ISO)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinoic acid (ISO)

alpha-hexylcinnamaldehyde (ISO)

amphetamine (EXP)

andrographolide (ISO)

aripiprazole (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

aspartame (ISO)

atorvastatin calcium (ISO)

atrazine (EXP)

axitinib (EXP)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

boron nitride (ISO)

busulfan (ISO)

butyric acid (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chloroprene (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

clofibrate (ISO)

clofibric acid (EXP)

clopidogrel (ISO)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

curcumin (ISO)

cycloheximide (ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (ISO)

cytarabine (ISO)

D-glucose (EXP,ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diethyl malate (ISO)

diethyl maleate (EXP)

diethylstilbestrol (ISO)

dimethylarsinous acid (ISO)

dioxygen (EXP)

dopamine (EXP)

dorsomorphin (ISO)

doxifluridine (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

equol (ISO)

ethanol (ISO)

fenamidone (ISO)

fenoldopam (EXP)

folic acid (ISO)

fulvestrant (ISO)

furosemide (EXP)

geldanamycin (ISO)

genistein (ISO)

gentamycin (EXP)

glucose (EXP,ISO)

glyphosate (ISO)

hydrogen cyanide (ISO)

hydrogen peroxide (ISO)

ibuprofen (ISO)

indometacin (ISO)

irinotecan (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

magnesium atom (ISO)

manganese(II) chloride (ISO)

medroxyprogesterone acetate (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

metoprolol (EXP)

mifepristone (ISO)

mono(2-ethylhexyl) phthalate (EXP)

monosodium L-glutamate (ISO)

N-acetyl-L-cysteine (EXP)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

okadaic acid (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

paricalcitol (ISO)

perfluorononanoic acid (ISO)

phenformin (EXP)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosgene (ISO)

phosphorus atom (ISO)

phosphorus(.) (ISO)

phthalaldehyde (ISO)

pioglitazone (EXP)

pirinixic acid (ISO)

potassium cyanide (ISO)

prednisolone (ISO)

progesterone (ISO)

protein kinase inhibitor (ISO)

quercetin (ISO)

raloxifene (ISO)

resveratrol (EXP)

rotenone (EXP)

SB 203580 (ISO)

SB 431542 (ISO)

senecionine (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (ISO)

sodium arsenite (ISO)

sodium aurothiomalate (ISO)

sodium fluoride (ISO)

Soman (EXP)

streptozocin (EXP)

succimer (ISO)

sulindac sulfide (ISO)

T-2 toxin (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thioacetamide (EXP)

ticlopidine (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vincaleukoblastine (EXP)

vincristine (EXP)

vorinostat (ISO)

zearalenone (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

behavioral response to pain (ISO)

blood vessel morphogenesis (ISO)

cell migration (ISO)

cellular response to growth factor stimulus (IEP)

cellular response to nitric oxide (ISO)

cellular response to tumor necrosis factor (IEP)

chronic inflammatory response (ISO)

endocardial cushion development (ISO)

engulfment of apoptotic cell (ISO)

growth plate cartilage development (ISO)

immune response (ISO)

inflammatory response (ISO)

monocyte aggregation (ISO)

negative regulation of angiogenesis (IBA,IDA,ISO)

negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of blood vessel endothelial cell migration (ISO)

negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis (ISO)

negative regulation of cell migration involved in sprouting angiogenesis (ISO)

negative regulation of cell population proliferation (ISO)

negative regulation of cell-matrix adhesion (ISO)

negative regulation of cGMP-mediated signaling (ISO)

negative regulation of dendritic cell antigen processing and presentation (ISO)

negative regulation of endothelial cell chemotaxis (ISO)

negative regulation of endothelial cell migration (ISO)

negative regulation of endothelial cell proliferation (ISO)

negative regulation of fibrinolysis (ISO)

negative regulation of fibroblast growth factor receptor signaling pathway (ISO)

negative regulation of interleukin-12 production (ISO)

negative regulation of long-chain fatty acid import across plasma membrane (ISO)

negative regulation of nitric oxide mediated signal transduction (ISO)

negative regulation of plasminogen activation (ISO)

negative regulation of sprouting angiogenesis (ISO)

outflow tract morphogenesis (ISO)

positive regulation of angiogenesis (ISO)

positive regulation of blood coagulation (ISO)

positive regulation of blood vessel endothelial cell migration (ISO)

positive regulation of cell migration (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of cell-substrate adhesion (ISO)

positive regulation of chemotaxis (ISO)

positive regulation of endothelial cell apoptotic process (ISO)

positive regulation of endothelial cell migration (ISO)

positive regulation of extrinsic apoptotic signaling pathway via death domain receptors (ISO)

positive regulation of fibroblast migration (ISO)

positive regulation of macrophage activation (ISO)

positive regulation of macrophage chemotaxis (ISO)

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO)

positive regulation of phosphorylation (ISO)

positive regulation of reactive oxygen species metabolic process (ISO)

positive regulation of smooth muscle cell proliferation (ISO)

positive regulation of transforming growth factor beta production (IMP)

positive regulation of transforming growth factor beta receptor signaling pathway (ISO)

positive regulation of translation (ISO)

positive regulation of tumor necrosis factor production (ISO)

response to calcium ion (ISO)

response to endoplasmic reticulum stress (ISO)

response to glucose (ISO)

response to magnesium ion (ISO)

response to mechanical stimulus (IMP)

response to testosterone (IEP)

response to xenobiotic stimulus (ISO)

sprouting angiogenesis (ISO)

Cellular Component

cell surface (ISO)

collagen-containing extracellular matrix (IBA)

endoplasmic reticulum (ISO)

external side of plasma membrane (ISO)

extracellular matrix (ISO)

extracellular space (IDA,ISO)

fibrinogen complex (ISO)

platelet alpha granule (ISO)

sarcoplasmic reticulum (ISO)

secretory granule (ISO)

Molecular Function

calcium ion binding (IEA)

collagen V binding (ISO)

endopeptidase inhibitor activity (ISO)

extracellular matrix binding (ISO)

fibrinogen binding (ISO)

fibroblast growth factor binding (ISO)

fibronectin binding (ISO)

heparin binding (ISO)

integrin binding (ISO)

laminin binding (ISO)

low-density lipoprotein particle binding (ISO)

phosphatidylserine binding (ISO)

protease binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

transforming growth factor beta binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

cell-extracellular matrix signaling pathway (IEA)

malaria pathway (IEA)

phagocytosis pathway (IEA)

syndecan signaling pathway (ISO)

transforming growth factor-beta superfamily mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomics analysis of human obesity reveals the epigenetic factor HDAC4 as a potential target for obesity.	Abu-Farha M, etal., PLoS One. 2013 Sep 24;8(9):e75342. doi: 10.1371/journal.pone.0075342. eCollection 2013.
2.	The role of thymidine phosphorylase and thrombospondin-1 in angiogenesis and progression of intrahepatic cholangiocarcinoma.	Aishima S, etal., Int J Surg Pathol. 2002 Jan;10(1):47-56.
3.	Capillary sprout endothelial cells exhibit a CD36 low phenotype: regulation by shear stress and vascular endothelial growth factor-induced mechanism for attenuating anti-proliferative thrombospondin-1 signaling.	Anderson CR, etal., Am J Pathol. 2008 Oct;173(4):1220-8. Epub 2008 Sep 4.
4.	A thrombospondin-1 antagonist of transforming growth factor-beta activation blocks cardiomyopathy in rats with diabetes and elevated angiotensin II.	Belmadani S, etal., Am J Pathol. 2007 Sep;171(3):777-89. Epub 2007 Jul 19.
5.	Thrombospondin 1 acts as a strong promoter of transforming growth factor beta effects via two distinct mechanisms in hepatic stellate cells.	Breitkopf K, etal., Gut. 2005 May;54(5):673-81.
6.	Androgens repress the expression of the angiogenesis inhibitor thrombospondin-1 in normal and neoplastic prostate.	Colombel M, etal., Cancer Res. 2005 Jan 1;65(1):300-8.
7.	Thrombospondin-1 is an endogenous activator of TGF-beta in experimental diabetic nephropathy in vivo.	Daniel C, etal., Diabetes. 2007 Dec;56(12):2982-9. Epub 2007 Sep 18.
8.	Protection of erythropoietin on experimental spinal cord injury by reducing the expression of thrombospondin-1 and transforming growth factor-beta.	Fang XQ, etal., Chin Med J (Engl). 2009 Jul 20;122(14):1631-5.
9.	Inflammation Profiling of Critically Ill Coronavirus Disease 2019 Patients.	Fraser DD, etal., Crit Care Explor. 2020 Jun 22;2(6):e0144. doi: 10.1097/CCE.0000000000000144. eCollection 2020 Jun.
10.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
11.	Aberrant CpG island methylation of multiple genes in intrahepatic cholangiocarcinoma.	Lee S, etal., Am J Pathol. 2002 Sep;161(3):1015-22.
12.	Identification and Validation of Stage-Associated Serum Biomarkers in Colorectal Cancer Using MS-Based Procedures.	Marín-Vicente C, etal., Proteomics Clin Appl. 2020 Jan;14(1):e1900052. doi: 10.1002/prca.201900052. Epub 2019 Sep 18.
13.	Methylation profile of circulating plasma DNA in patients with pancreatic cancer.	Melnikov AA, etal., J Surg Oncol. 2009 Feb 1;99(2):119-22.
14.	Stromal expression of thrombospondin-1 is correlated with growth and metastasis of human gallbladder carcinoma.	Ohtani Y, etal., Int J Oncol. 1999 Sep;15(3):453-7.
15.	Stromal thrombospondin-1 expression is a prognostic indicator and a new marker of invasiveness in intraductal papillary-mucinous neoplasm of the pancreas.	Okada K, etal., Biomed Res. 2010;31(1):13-9.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
18.	GOA pipeline	RGD automated data pipeline
19.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Thrombospondin-1 is induced in rat myocardial infarction and its induction is accelerated by ischemia/reperfusion.	Sezaki S, etal., Exp Biol Med (Maywood). 2005 Oct;230(9):621-30.
22.	Association of angiogenesis related markers with bladder cancer outcomes and other molecular markers.	Shariat SF, etal., J Urol. 2010 May;183(5):1744-50. doi: 10.1016/j.juro.2010.01.018. Epub 2010 Mar 17.
23.	Angiogenesis in cholangiocellular carcinoma: expression of vascular endothelial growth factor, angiopoietin-1/2, thrombospondin-1 and clinicopathological significance.	Tang D, etal., Oncol Rep. 2006 Mar;15(3):525-32.
24.	Thrombospondin-1 expression as a prognostic predictor of pancreatic ductal carcinoma.	Tobita K, etal., Int J Oncol. 2002 Dec;21(6):1189-95.
25.	Purinergic signaling induces thrombospondin-1 expression in astrocytes.	Tran MD and Neary JT, Proc Natl Acad Sci U S A. 2006 Jun 13;103(24):9321-6. Epub 2006 Jun 5.
26.	Hypermethylation of multiple genes in pancreatic adenocarcinoma.	Ueki T, etal., Cancer Res. 2000 Apr 1;60(7):1835-9.
27.	Thrombospondins, metallo proteases and thrombospondin receptors messenger RNA and protein expression in different tumour sublines of the Dunning prostate cancer model.	Vallbo C and Damber JE, Acta Oncol. 2005;44(3):293-8.
28.	[The study of thrombospondin-I (TSP1) expression in the early stages of diabetic retinopathy induced by streptozotocin]	Wang JY, etal., Fen Zi Xi Bao Sheng Wu Xue Bao. 2006 Oct;39(5):431-7.
29.	Expression of angiogenic factors is upregulated in DMBA-induced rat mammary pathologies.	Yan M, etal., Pathobiology. 2004;71(5):253-60.
30.	Activation of rat alveolar macrophage-derived latent transforming growth factor beta-1 by plasmin requires interaction with thrombospondin-1 and its cell surface receptor, CD36.	Yehualaeshet T, etal., Am J Pathol. 1999 Sep;155(3):841-51.
31.	Continuous administration of the three thrombospondin-1 type 1 repeats recombinant protein improves the potency of therapy in an orthotopic human pancreatic cancer model.	Zhang X, etal., Cancer Lett. 2007 Mar 8;247(1):143-9. Epub 2006 Jun 6.
32.	[The role of glucose/TSP-1/TGFbeta1 signal pathways in diabetic cardiomyopathy]	Zhong M, etal., Zhonghua Xin Xue Guan Bing Za Zhi. 2006 Mar;34(3):217-21.
33.	Alteration of thrombospondin-1 and -2 in rat brains following experimental intracerebral hemorrhage.	Zhou HJ, etal., J Neurosurg. 2010 Feb 5.

Additional References at PubMed

PMID:101549	PMID:2435757	PMID:3084490	PMID:3997886	PMID:6341993	PMID:6438154	PMID:6693501	PMID:6777381	PMID:8288588	PMID:9006956	PMID:9657149	PMID:11961406
PMID:12498716	PMID:12511771	PMID:12882934	PMID:12937160	PMID:14717916	PMID:15184388	PMID:15700281	PMID:15963261	PMID:16019429	PMID:16150726	PMID:16294224	PMID:16310163
PMID:16502470	PMID:16882710	PMID:17381066	PMID:17413041	PMID:17416590	PMID:17596205	PMID:17879962	PMID:17996481	PMID:18045834	PMID:18096704	PMID:18407596	PMID:18467703
PMID:18555217	PMID:18575624	PMID:18653767	PMID:18674744	PMID:18722097	PMID:18726995	PMID:18757424	PMID:18757743	PMID:18940719	PMID:19056867	PMID:19127780	PMID:19189070
PMID:19199708	PMID:19278574	PMID:19342245	PMID:19571575	PMID:19734591	PMID:19738618	PMID:19818485	PMID:19821086	PMID:20016205	PMID:20026598	PMID:20080874	PMID:20215829
PMID:20524210	PMID:20551380	PMID:20878350	PMID:20889977	PMID:21152035	PMID:21362503	PMID:21394550	PMID:21422735	PMID:22206666	PMID:22418977	PMID:22455124	PMID:22682248
PMID:22745497	PMID:22776902	PMID:23009856	PMID:23043906	PMID:23087362	PMID:23144964	PMID:23376485	PMID:23533145	PMID:23541831	PMID:23658023	PMID:23843515	PMID:23979707
PMID:24006456	PMID:24121060	PMID:24177325	PMID:24615654	PMID:25387836	PMID:25660232	PMID:25884585	PMID:25958163	PMID:26092525	PMID:26395742	PMID:27068509	PMID:27588705
PMID:27735996	PMID:28124060	PMID:28228282	PMID:29408825	PMID:29683384	PMID:30360646	PMID:30537736	PMID:30720765	PMID:34015597	PMID:34957570	PMID:36528876	PMID:36920202

Genomics

Comparative Map Data

Thbs1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	105,056,293 - 105,071,445 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	105,056,292 - 105,071,440 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	108,721,861 - 108,736,913 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	117,317,382 - 117,332,433 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	114,977,769 - 114,992,820 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	109,862,120 - 109,873,466 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	109,862,117 - 109,873,466 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	116,411,045 - 116,422,101 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	3	103,978,436 - 103,990,486 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

THBS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	39,581,079 - 39,599,466 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	39,581,079 - 39,599,466 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	39,873,280 - 39,891,667 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	37,660,572 - 37,676,960 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	37,660,571 - 37,676,959	NCBI
Celera	15	16,636,119 - 16,652,508 (+)	NCBI		Celera
Cytogenetic Map	15	q14	NCBI
HuRef	15	16,716,691 - 16,733,080 (+)	NCBI		HuRef
CHM1_1	15	39,992,660 - 40,009,050 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	37,385,886 - 37,404,273 (+)	NCBI		T2T-CHM13v2.0

Thbs1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	117,942,357 - 117,957,614 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	117,942,357 - 117,957,614 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	118,111,876 - 118,127,133 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	118,111,876 - 118,127,133 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	117,937,658 - 117,952,869 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	119,046,897 - 119,061,990 (+)	NCBI		MGSCv36	mm8
MGSCv36	2	117,803,363 - 117,818,574 (+)	NCBI		MGSCv36	mm8
Celera	2	119,257,347 - 119,271,479 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	59.34	NCBI

Thbs1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	6,489,451 - 6,506,419 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	6,490,034 - 6,506,419 (+)	NCBI	ChiLan1.0	ChiLan1.0

THBS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	15	32,972,998 - 32,987,997 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	18,521,802 - 18,538,172 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	36,776,756 - 36,793,469 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	36,776,756 - 36,793,170 (+)	Ensembl	panpan1.1		panPan2

THBS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	6,770,212 - 6,786,875 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	6,769,470 - 6,784,915 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	6,824,809 - 6,841,468 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	6,896,290 - 6,912,963 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	6,895,539 - 6,911,152 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	6,820,232 - 6,836,894 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	6,926,083 - 6,942,777 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	7,055,241 - 7,071,904 (+)	NCBI		UU_Cfam_GSD_1.0

Thbs1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	85,216,385 - 85,233,062 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	3,064,422 - 3,081,949 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936471	3,064,466 - 3,081,125 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

THBS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	131,728,784 - 131,746,115 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	131,728,781 - 131,746,098 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	146,905,998 - 146,923,315 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

THBS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	43,410,693 - 43,427,816 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	43,410,580 - 43,427,812 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	97,515,387 - 97,532,504 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Thbs1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624804	6,849,670 - 6,867,684 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624804	6,849,660 - 6,866,164 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Thbs1
71 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	54
Count of miRNA genes:	48
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000070912
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat

Markers in Region

M87276

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	105,069,602 - 105,069,776 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	109,873,417 - 109,873,590	NCBI	Rnor6.0
Rnor_5.0	3	116,422,052 - 116,422,225	UniSTS	Rnor5.0
Celera	3	103,990,437 - 103,990,610	UniSTS

PMC152639P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	105,068,151 - 105,068,227 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	109,871,965 - 109,872,040	NCBI	Rnor6.0
Rnor_5.0	3	116,420,600 - 116,420,675	UniSTS	Rnor5.0
Celera	3	103,988,986 - 103,989,061	UniSTS

Thbs1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_6.0	3	109,867,214 - 109,867,537	NCBI	Rnor6.0
Rnor_5.0	3	116,415,849 - 116,416,172	UniSTS	Rnor5.0
Celera	3	103,984,219 - 103,984,549	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	28	25	22	11	22	6	7	39	35	33	11	6
Low	1	15	31	18	8	18	2	4	35		8		2
Below cutoff			1	1		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF309630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227032	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000070912 ⟹ ENSRNOP00000066041

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	109,862,120 - 109,873,466 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000083351 ⟹ ENSRNOP00000069322

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	105,056,292 - 105,071,440 (+)	Ensembl
Rnor_6.0 Ensembl	3	109,862,117 - 109,872,871 (+)	Ensembl

RefSeq Acc Id:

NM_001013062 ⟹ NP_001013080

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	105,056,293 - 105,071,445 (+)	NCBI
Rnor_6.0	3	109,862,120 - 109,873,466 (+)	NCBI
Rnor_5.0	3	116,411,045 - 116,422,101 (+)	NCBI
Celera	3	103,978,436 - 103,990,486 (+)	RGD

Sequence:

show sequence

CACACACGCTCCGCGTTGGGCACAAAGGCTCCACCATGGAGCTCCTCAGGGGACTAGGCGTCCT
GTTCCTGTTGCATGTGTGTGGAAGCAACCGCATTCCAGAGTCTGGGGGAGACAATGGTGTGTTC
GACATTTTTGAACTCATTGGAGGTGCCCGCAAGGTTCCGGGTCGCCGACTGGTGAAGGGCCAAG
ATCTATCCAGCCCCGCCTTCCGGATCGAGAATGCCAACCTGATCCCCCCTGTGCCAGATGACAA
GTTCCAAGACCTACTGGACGCTGTGTGGGCCGACAAAGGCTTCATCTTCCTGGCTTCCTTGAGG
CAGATGAAGAAGACTCGGGGCACACTCCTGGCCGTGGAACGGAAAGACAATTCTGGCCAGATCT
TCAGTGTGGTCTCCAATGGCAAAGCCGGCACCCTCGATCTGAGTCTGAGCCTGCCCGGGAAGCA
GCAAGTGGTGTCAGTGGAGGAAGCTCTCCTGGCCACTGGCCAGTGGAAGAGCATCACGCTGTTT
GTCCAAGAAGACAGGGCCCAGCTCTACATTGACTGTGACAAGATGGAGAGCGCAGAGCTGGATG
TTCCCATCCAGAGCATCTTCACAAGGGATTTGGCCAATGTCGCCAGGCTCCGAGTCGCAAAGGG
AGATGTCAATGACAATTTTCAGGGGGTGCTGCAGAATGTGAGGTTTGTCTTTGGAACCACCCCA
GAAGACATTCTCAGGAACAAAGGCTGCTCCAGTTCAACCAACGTCCTTCTCACCCTTGACAACA
ACGTGGTGAACGGTTCCAGCCCTGCCATCCGCACCAACTACATCGGCCACAAAACAAAGGACCT
CCAAGCCATCTGTGGCCTCTCCTGTGACGAACTATCCAGCATGGTCCTGGAACTGAGGGGCCTG
CGTACCATCGTGACCACGCTACAGGACAGCATTCGCAAAGTGACGGAAGAGAACAGAGAGCTGG
CTAGCGAGCTGAGGCGGCCTCCCCTCTGCTTCCACAATGGAGTCCAATACAGGAACAACGAGGA
GTGGACTGTAGATAGTTGCACAGAGTGTCACTGCCAGAACTCAGTTACCATCTGCAAAAAGGTG
TCCTGTCCCATCATGCCCTGCTCCAATGCCACAGTTCCTGATGGTGAATGCTGCCCACGGTGCT
GGCCCAGTGACTCTGCTGACGATGGCTGGTCTCCCTGGTCTGAGTGGACCTCTTGCTCTGCCAC
CTGTGGCAATGGGATTCAGCAACGTGGTCGCTCCTGTGACAGCCTCAACAACAGATGTGAGGGC
TCTTCAGTACAGACGAGGACCTGCCACATTCAGGAGTGCGACAAAAGATTTAAACAGGATGGTG
GTTGGAGTCACTGGTCCCCGTGGTCGTCCTGTTCTGTGACCTGTGGTGACGGTGTGATCACGAG
GATCCGACTCTGCAACTCCCCCAGCCCCCAGATGAACGGGAAGCCCTGTGAAGGTGAAGCTCGG
GAGACCAAAGCCTGCAAGAAGGACGCCTGCCCAATCAATGGAGGCTGGAGTCCCTGGTCACTAT
GGGACATCTGCTCTGTCACCTGTGGAGGAGGAGTACAGAGACGTAGCCGACTCTGCAACAACCC
CACACCCCAGTTTGGAGGCAAAGACTGTGTTGGTGATGTGACGGAAAATCAAGTTTGCAACAAG
CAGGACTGTCCGATTGATGGATGCCTGTCCAATCCCTGCTTTGCTGGTGCCAAGTGTACGAGCT
ATCCTGATGGTAGCTGGAAATGTGGTGCGTGTCCTCCTGGCTACAGTGGAAATGGTATCCAGTG
CAAAGACGTCGACGAGTGCAAAGAAGTGCCTGATGCTTGCTTCAATCACAACGGGGAACATCGG
TGCAAGAACACAGATCCTGGCTACAACTGCCTGCCCTGCCCACCACGATTCACCGGCTCACAGC
CCTTCGGCAGAGGTGTCGAACACGCTATGGCCAACAAACAGGTGTGCAAACCCCGAAACCCCTG
CACCGACGGGACACACGACTGCAACAAGAACGCCAAGTGCAACTACCTGGGTCACTACAGCGAC
CCCATGTACCGCTGCGAGTGCAAGCCTGGCTATGCAGGCAATGGCATCATTTGCGGAGAGGACA
CAGACCTTGACGGCTGGCCTAATGAAAACCTGGTGTGTGTGGCCAACGCAACCTACCACTGCAA
AAAGGACAACTGCCCCAATCTTCCCAATTCGGGGCAGGAAGACTATGACAAGGATGGGATTGGC
GATGCCTGTGATGACGATGATGACAACGACAAGATTCCTGATGACAGGGACAACTGTCCATTCC
ATTACAACCCTGCCCAGTATGACTATGACAGAGATGATGTGGGAGACCGCTGTGACAATTGCCC
CTACAACCACAACCCTGACCAGGCAGACACAGACAACAATGGGGAGGGAGATGCCTGCGCTGTG
GACATCGATGGGGATGGAATCCTCAATGAACGAGACAACTGCCAGTATGTTTACAACGTGGATC
AGAGGGACACGGACATGGATGGGGTTGGAGACCAGTGTGACAACTGCCCCCTGGAACACAATCC
AGACCAGCTGGACTCTGACTCGGACCGCATAGGGGACACCTGTGACAACAATCAGGCCATCGAT
GAGGATGGCCATCAGAACAACCTTGAAAACTGTCCCTATGTGCCCAATGCCAACCAGGCCGACC
ACGATAAAGATGGTAAAGGAGACGCCTGTGACCATGACGATGACAACGACGGCATCCCTGATGA
CAGAGACAACTGCAGGCTGGTGCCCAATCCTGACCAGAAGGACTCTGATGGTGATGGCCGAGGC
GATGCCTGCAAAGACGACTTTGACCATGACAATGTGCCAGACATTGATGACATCTGTCCTGAGA
ATGTTGACATCAGTGAAACCGATTTCCGCCGATTCCAGATGATTCCTCTAGATCCCAAAGGAAC
CTCCCAAAATGACCCTAACTGGGTTGTCCGCCATCAGGGCAAAGAACTTGTCCAGACTGTAAAC
TGTGACCCTGGACTTGCTGTAGGTTATGATGAGTTTAATGCCGTGGACTTCAGTGGTACCTTCT
TCATCAACACTGAGAGGGATGACGACTATGCTGGCTTTGTTTTCGGGTACCAGTCCAGCAGCCG
CTTCTACGTTGTGATGTGGAAACAAGTCACCCAGTCCTACTGGGACACCAACCCCACAAGGGCT
CAGGGATACTCAGGCCTGTCTGTAAAGGTTGTAAACTCCACCACTGGCCCCGGCGAGCACCTGC
GGAATGCACTGTGGCACACAGGAAACACCCCTGGCCAGGTGCGCACCCTGTGGCATGACCCTCG
TCACATTGGCTGGAAAGATTTCACTGCATACAGATGGCGTCTCAGCCACAGGCCAAAGACCGGT
TTGATCAGAGTGGTGATGTATGAAGGAAAGAAAATCATGGCTGACTCAGGACCCATCTATGACA
AAACCTACGCTGGCGGTAGACTAGGCCTGTTCGTCTTCTCTCAAGAAATGGTGTTCTTCTCGGA
CATGAAATACGAGTGCCGAGACTCCTAATCACCACCCCGATCATAACCAGCCTGGCATTGCACC
TTCCGAAACCAAGGGCTAGAGAAAAACCCCTCCAGGATCGCTTCTCCTCGCCTTCCCTGCCTCT
CTTCTTGCATAGTGTGGGCTTCTAGAGTCTGTGACCTGCCTCAAGAAAATGCAGTTTTCAAAAC
CGTAGGCCAGACTCAAGAACTT

hide sequence

RefSeq Acc Id:

NM_001398940 ⟹ NP_001385869

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	105,056,293 - 105,071,445 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013080	(Get FASTA)	NCBI Sequence Viewer
	NP_001385869	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ14549	(Get FASTA)	NCBI Sequence Viewer
	EDL79850	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013080 ⟸ NM_001013062
- Peptide Label:	isoform 1 precursor
- UniProtKB:	Q71SA3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MELLRGLGVLFLLHVCGSNRIPESGGDNGVFDIFELIGGARKVPGRRLVKGQDLSSPAFRIENA NLIPPVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNSGQIFSVVSNGKAGTL DLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELDVPIQSIFTRDLA NVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLLTLDNNVVNGSSPAIRT NYIGHKTKDLQAICGLSCDELSSMVLELRGLRTIVTTLQDSIRKVTEENRELASELRRPPLCFH NGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSP WSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCS VTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWSPWSLWDICSVTCGGGV QRRSRLCNNPTPQFGGKDCVGDVTENQVCNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACP PGYSGNGIQCKDVDECKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMAN KQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLV CVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRD DVGDRCDNCPYNHNPDQADTDNNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQ CDNCPLEHNPDQLDSDSDRIGDTCDNNQAIDEDGHQNNLENCPYVPNANQADHDKDGKGDACDH DDDNDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRRF QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAG FVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPG QVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGLIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFV FSQEMVFFSDMKYECRDS hide sequence

RefSeq Acc Id:

ENSRNOP00000066041 ⟸ ENSRNOT00000070912

RefSeq Acc Id:

ENSRNOP00000069322 ⟸ ENSRNOT00000083351

RefSeq Acc Id:	NP_001385869 ⟸ NM_001398940
- Peptide Label:	isoform 2 precursor
- UniProtKB:	A0A0G2JV24 (UniProtKB/TrEMBL), Q71SA3 (UniProtKB/TrEMBL)

Protein Domains

EGF-like TSP C-terminal VWFC

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JV24-F1-model_v2	AlphaFold	A0A0G2JV24	1-1152	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1588455	AgrOrtholog
BioCyc Gene	G2FUF-48263	BioCyc
Ensembl Genes	ENSRNOG00000045829	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000069322	ENTREZGENE
	ENSRNOP00000069322.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000083351	ENTREZGENE
	ENSRNOT00000083351.2	UniProtKB/TrEMBL
Gene3D-CATH	2.20.100.10	UniProtKB/TrEMBL
	2.60.120.200	UniProtKB/TrEMBL
	4.10.1080.10	UniProtKB/TrEMBL
	6.20.200.20	UniProtKB/TrEMBL
	Laminin	UniProtKB/TrEMBL
InterPro	ConA-like_subgrp	UniProtKB/TrEMBL
	EG-like_dom	UniProtKB/TrEMBL
	EGF-like_Ca-bd	UniProtKB/TrEMBL
	EGF_dom	UniProtKB/TrEMBL
	Laminin_G	UniProtKB/TrEMBL
	Thrombospondin_1_rpt	UniProtKB/TrEMBL
	Thrombospondin_3-like_rpt	UniProtKB/TrEMBL
	Thrombospondin_3_rpt	UniProtKB/TrEMBL
	Thrombospondin_C	UniProtKB/TrEMBL
	TSP1_rpt_sf	UniProtKB/TrEMBL
	TSP_type-3_rpt	UniProtKB/TrEMBL
	VWF_C	UniProtKB/TrEMBL
KEGG Report	rno:445442	UniProtKB/TrEMBL
NCBI Gene	445442	ENTREZGENE
PANTHER	PTHR10199:SF78	UniProtKB/TrEMBL
	THROMBOSPONDIN	UniProtKB/TrEMBL
Pfam	EGF_3	UniProtKB/TrEMBL
	Laminin_G_2	UniProtKB/TrEMBL
	TSP_1	UniProtKB/TrEMBL
	TSP_3	UniProtKB/TrEMBL
	TSP_C	UniProtKB/TrEMBL
	VWC	UniProtKB/TrEMBL
PhenoGen	Thbs1	PhenoGen
PRINTS	TSP1REPEAT	UniProtKB/TrEMBL
PROSITE	EGF_2	UniProtKB/TrEMBL
	EGF_3	UniProtKB/TrEMBL
	TSP1	UniProtKB/TrEMBL
	TSP3	UniProtKB/TrEMBL
	TSP_CTER	UniProtKB/TrEMBL
	VWFC_1	UniProtKB/TrEMBL
	VWFC_2	UniProtKB/TrEMBL
SMART	EGF	UniProtKB/TrEMBL
	EGF_CA	UniProtKB/TrEMBL
	TSP1	UniProtKB/TrEMBL
	TSPN	UniProtKB/TrEMBL
	VWC	UniProtKB/TrEMBL
Superfamily-SCOP	ConA_like_lec_gl	UniProtKB/TrEMBL
	EGF/Laminin	UniProtKB/TrEMBL
	FnI-like domain	UniProtKB/TrEMBL
	SSF103647	UniProtKB/TrEMBL
	TSP1	UniProtKB/TrEMBL
UniProt	A0A0G2JV24	ENTREZGENE, UniProtKB/TrEMBL
	A6HP99_RAT	UniProtKB/TrEMBL
	Q71SA3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-11-19	Thbs1	thrombospondin 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)