Romo1 (reactive oxygen species modulator 1)

Advanced Search (OLGA)

Gene: Romo1 (reactive oxygen species modulator 1) Rattus norvegicus

Analyze

Symbol:

Romo1

Name:

reactive oxygen species modulator 1

RGD ID:

1587111

Description:

Predicted to enable monoatomic cation transmembrane transporter activity. Predicted to be involved in several processes, including antimicrobial humoral immune response mediated by antimicrobial peptide; protein targeting to mitochondrion; and replicative senescence. Predicted to be located in mitochondrion. Predicted to be part of TIM23 mitochondrial import inner membrane translocase complex. Predicted to be active in mitochondrial inner membrane. Biomarker of ureteral obstruction. Orthologous to human ROMO1 (reactive oxygen species modulator 1); PARTICIPATES IN presequence pathway of mitochondrial protein import; INTERACTS WITH 3-chloropropane-1,2-diol; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100910944; LOC679572; reactive oxygen species modulator 1-like; similar to CG6878-PA

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ROMO1 (reactive oxygen species modulator 1)	HGNC	Ensembl, HomoloGene, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Romo1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Romo1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ROMO1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ROMO1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Romo1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ROMO1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ROMO1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Romo1 (reactive oxygen species modulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NAPG (NSF attachment protein gamma)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ROMO1 (reactive oxygen species modulator 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Romo1 (reactive oxygen species modulator 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	romo1 (reactive oxygen species modulator 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MGR2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6878	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	romo-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	romo1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	165,119,794 - 165,121,394 (+)	NCBI		GRCr8
mRatBN7.2	3	144,659,709 - 144,661,310 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	144,659,826 - 144,661,310 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	148,525,487 - 148,527,086 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	157,142,757 - 157,144,356 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	154,882,282 - 154,883,881 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	151,688,213 - 151,689,813 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	152,222,726 - 152,224,326 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	3	151,688,454 - 151,689,711 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	158,052,831 - 158,054,431 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	146,551,220 - 146,552,820 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	143,381,479 - 143,383,079 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ureteral obstruction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

6-propyl-2-thiouracil (EXP)

alpha-Zearalanol (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

chloropicrin (ISO)

chlorpyrifos (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flutamide (EXP)

hydralazine (ISO)

indometacin (ISO)

ivermectin (ISO)

lead diacetate (ISO)

leflunomide (EXP)

methidathion (ISO)

methimazole (EXP)

Monobutylphthalate (ISO)

monosodium L-glutamate (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

potassium dichromate (ISO)

propiconazole (EXP)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

tolcapone (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (ISO)

biological_process (ND)

cellular response to reactive oxygen species (ISO)

cytolysis by host of symbiont cells (IEA)

defense response to Gram-negative bacterium (IEA)

defense response to Gram-positive bacterium (IEA)

monoatomic cation transmembrane transport (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of reactive oxygen species metabolic process (ISO)

protein import into mitochondrial matrix (IBA)

protein insertion into mitochondrial inner membrane (IBA,ISO)

replicative senescence (ISO)

Cellular Component

mitochondrial inner membrane (ISO)

mitochondrion (ISO)

TIM23 mitochondrial import inner membrane translocase complex (IBA,ISO)

Molecular Function

monoatomic cation transmembrane transporter activity (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

presequence pathway of mitochondrial protein import (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Reactive oxygen species modulator 1 regulates oxidative stress and induces renal and pulmonary fibrosis in a unilateral ureteral obstruction rat model and in HK-2 cells.	Liu D, etal., Mol Med Rep. 2017 Oct;16(4):4855-4862. doi: 10.3892/mmr.2017.7161. Epub 2017 Aug 3.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	Unlocking the presequence import pathway.	Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
6.	Cooperation of protein machineries in mitochondrial protein sorting.	Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.

Additional References at PubMed

PMID:12947022	PMID:14651853	PMID:16842742	PMID:18313394	PMID:18614015	PMID:18836179	PMID:22083756

Genomics

Comparative Map Data

Romo1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	165,119,794 - 165,121,394 (+)	NCBI		GRCr8
mRatBN7.2	3	144,659,709 - 144,661,310 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	144,659,826 - 144,661,310 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	148,525,487 - 148,527,086 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	157,142,757 - 157,144,356 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	154,882,282 - 154,883,881 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	151,688,213 - 151,689,813 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	152,222,726 - 152,224,326 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	3	151,688,454 - 151,689,711 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	158,052,831 - 158,054,431 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	146,551,220 - 146,552,820 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	143,381,479 - 143,383,079 (+)	NCBI		Celera
Cytogenetic Map	3	q42	NCBI

ROMO1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	35,699,405 - 35,700,980 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	35,699,272 - 35,700,984 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	34,287,327 - 34,288,902 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	33,750,646 - 33,752,316 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	33,750,805 - 33,752,315	NCBI
Celera	20	31,035,527 - 31,037,197 (+)	NCBI		Celera
Cytogenetic Map	20	q11.22	NCBI
HuRef	20	31,064,615 - 31,066,285 (+)	NCBI		HuRef
CHM1_1	20	34,189,163 - 34,190,833 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	37,420,181 - 37,421,955 (+)	NCBI		T2T-CHM13v2.0

Romo1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	155,986,073 - 155,987,714 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	155,985,959 - 155,987,717 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	156,144,153 - 156,145,794 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	156,144,039 - 156,145,797 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	155,969,889 - 155,971,530 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	155,835,715 - 155,837,234 (+)	NCBI		MGSCv36	mm8
Celera	2	162,079,729 - 162,081,370 (+)	NCBI		Celera
Cytogenetic Map	2	H1	NCBI
cM Map	2	77.36	NCBI

Romo1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	25,757,558 - 25,759,769 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	25,757,558 - 25,760,054 (-)	NCBI	ChiLan1.0	ChiLan1.0

ROMO1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	41,431,785 - 41,433,435 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	41,424,888 - 41,426,538 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	32,026,660 - 32,028,314 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	33,147,657 - 33,149,347 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	33,148,002 - 33,149,345 (+)	Ensembl	panpan1.1		panPan2

ROMO1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	24,614,920 - 24,616,586 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	24,615,197 - 24,616,582 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1 Ensembl	25	49,713,624 - 49,713,863 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	24,259,936 - 24,261,608 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	25,307,430 - 25,309,102 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	25,307,713 - 25,309,098 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	24,593,720 - 24,595,391 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	24,688,801 - 24,690,473 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	25,128,217 - 25,129,889 (+)	NCBI		UU_Cfam_GSD_1.0

Romo1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	173,613,815 - 173,615,481 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936561	5,134,015 - 5,135,748 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936561	5,134,068 - 5,135,734 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ROMO1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	39,028,977 - 39,031,122 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	39,029,221 - 39,030,941 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	44,379,823 - 44,381,543 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ROMO1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	56,617,468 - 56,619,136 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	56,617,538 - 56,619,188 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666087	2,960,493 - 2,962,170 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Romo1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624842	3,734,441 - 3,736,081 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624842	3,734,441 - 3,736,382 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Romo1
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	33
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000026856, ENSRNOT00000072464
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1298068	Bp167	Blood pressure QTL 167		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141074471	169034231	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
2298477	Eau4	Experimental allergic uveoretinitis QTL 4		0.0011	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	3	137398739	169034231	Rat
61335	Bp20	Blood pressure QTL 20	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	141339236	155617360	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1331726	Bp208	Blood pressure QTL 208	3.129		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	141339013	162184794	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
5686842	Rf59	Renal function QTL 59			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	3	140069424	146976080	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
8552952	Pigfal13	Plasma insulin-like growth factor 1 level QTL 13			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	138799500	169034231	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat

Markers in Region

RH139369

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	144,661,193 - 144,661,261 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	152,224,210 - 152,224,277	NCBI	Rnor6.0
Rnor_6.0	3	151,689,697 - 151,689,764	NCBI	Rnor6.0
Rnor_5.0	3	159,466,504 - 159,466,571	UniSTS	Rnor5.0
Rnor_5.0	3	158,054,315 - 158,054,382	UniSTS	Rnor5.0
RGSC_v3.4	3	146,552,704 - 146,552,771	UniSTS	RGSC3.4
Celera	3	143,382,963 - 143,383,030	UniSTS
RH 3.4 Map	3	1328.6	UniSTS
Cytogenetic Map	3	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
12	12	62	68	60	36	12	36	12	116	48	38	20	38	24

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001195490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC118414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF108387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026856 ⟹ ENSRNOP00000026856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	151,688,454 - 151,689,711 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000072464 ⟹ ENSRNOP00000064235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	144,659,826 - 144,661,310 (+)	Ensembl
Rnor_6.0 Ensembl	3	152,222,726 - 152,224,326 (+)	Ensembl

RefSeq Acc Id:

NM_001195490 ⟹ NP_001182419

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	165,119,794 - 165,121,394 (+)	NCBI
mRatBN7.2	3	144,659,709 - 144,661,310 (+)	NCBI
Rnor_6.0	3	151,688,213 - 151,689,813 (+)	NCBI
Rnor_5.0	3	158,052,831 - 158,054,431 (+)	NCBI
Celera	3	143,381,479 - 143,383,079 (+)	NCBI

Sequence:

show sequence

AGCGCCCTCCGCCTAGCTTTCGGTGTGAGACGTCGAGCTGAGCGACCGCGGCAGAGAACGAGAT
GCCGGTGGCTGTGGGTCCCTACGGGCAGTCCCAGCCCAGCTGCTTCGACCGCGTGAAGATGGGC
TTTGTCATGGGTTGCGCCGTGGGTATGGCGGCCGGGGCCCTGTTCGGCACCTTCTCCTGTCTCA
GGATCGGAATGCGGGGTCGGGAGCTGATGGGCGGCATTGGGAAAACCATGATGCAGAGTGGCGG
TACCTTTGGCACTTTCATGGCCATCGGAATGGGCATACGATGCTAATTAGGGCACGGATGCCCT
GCTACACCCAAACTTCCTCATCCATTTCGAACCTTGTACAATAAAGTTTTTTTCTTCTTGTTAT
CAGTCTAATTTGACTTCAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001182419	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL85863	(Get FASTA)	NCBI Sequence Viewer
	EDL85864	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064235.1

RefSeq Acc Id:	NP_001182419 ⟸ NM_001195490
- UniProtKB:	D4A742 (UniProtKB/TrEMBL), A6KI91 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSG GTFGTFMAIGMGIRC hide sequence

Ensembl Acc Id:

ENSRNOP00000026856 ⟸ ENSRNOT00000026856

Ensembl Acc Id:

ENSRNOP00000064235 ⟸ ENSRNOT00000072464

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A742-F1-model_v2	AlphaFold	D4A742	1-79	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1587111	AgrOrtholog
BioCyc Gene	G2FUF-47103	BioCyc
Ensembl Genes	ENSRNOG00000019823	Ensembl
	ENSRNOG00000045555	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000072464.3	UniProtKB/TrEMBL
InterPro	Romo1	UniProtKB/TrEMBL
KEGG Report	rno:679572	UniProtKB/TrEMBL
NCBI Gene	679572	ENTREZGENE
PANTHER	PTHR28525	UniProtKB/TrEMBL
	REACTIVE OXYGEN SPECIES MODULATOR 1	UniProtKB/TrEMBL
Pfam	Mit_gmP	UniProtKB/TrEMBL
PhenoGen	Romo1	PhenoGen
RatGTEx	ENSRNOG00000019823	RatGTEx
	ENSRNOG00000045555	RatGTEx
SMART	Romo1	UniProtKB/TrEMBL
UniProt	A6KI91	ENTREZGENE, UniProtKB/TrEMBL
	D4A742	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Romo1	reactive oxygen species modulator 1	LOC100910944	reactive oxygen species modulator 1-like	Data merged from RGD:6496011	737654	PROVISIONAL
2012-07-05	LOC100910944	reactive oxygen species modulator 1-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-04-21	Romo1	reactive oxygen species modulator 1	LOC679572	similar to CG6878-PA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC679572	similar to CG6878-PA	LOC683563	similar to CG6878-PA	Data merged from RGD:1585631	1643240	APPROVED
2006-11-19	LOC679572	similar to CG6878-PA			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC683563	similar to CG6878-PA			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations