Advanced Search (OLGA)

Gene: Calml4 (calmodulin-like 4) Rattus norvegicus

Analyze

Symbol:

Calml4

Name:

calmodulin-like 4

RGD ID:

1583918

Description:

Predicted to enable calcium ion binding activity; enzyme regulator activity; and myosin head/neck binding activity. Predicted to be involved in brush border assembly and microtubule cytoskeleton organization. Predicted to be located in microvillus. Predicted to be active in cytoplasm. Orthologous to human CALML4 (calmodulin like 4); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

calmodulin-like protein 4; LOC691455; similar to calmodulin-like 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CALML4 (calmodulin like 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Calml4 (calmodulin-like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CALML4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Calml4 (calmodulin like 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CALML4 (calmodulin like 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Calml4 (calmodulin-like 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	calml4a (calmodulin-like 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	calml4b (calmodulin-like 4b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG17272	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T09B4.4	Alliance	DIOPT (PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	cal-1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	cal-3	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Caenorhabditis elegans (roundworm):	pat-10	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	calml4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	72,218,870 - 72,230,650 (+)	NCBI		GRCr8
mRatBN7.2	8	63,323,426 - 63,335,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	63,323,351 - 63,335,234 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	68,838,506 - 68,850,149 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	67,110,960 - 67,122,603 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	64,980,956 - 64,992,609 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	67,753,279 - 67,765,359 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	67,753,279 - 67,765,358 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	67,007,122 - 67,018,886 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	62,738,382 - 62,750,146 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Calml4	Rat	Bloom syndrome		ISO	RGD:1344788	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Calml4	Rat	colorectal cancer		ISO	RGD:1344788	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Calml4	Rat	neuronal ceroid lipofuscinosis		ISO	RGD:1344788	8554872	ClinVar Annotator: match by term: Neuronal ceroid lipofuscinosis	ClinVar	PMID:28492532

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Calml4	Rat	(-)-demecolcine	decreases expression	ISO	RGD:1344788	6480464	Demecolcine results in decreased expression of CALML4 mRNA	CTD	PMID:23649840
Calml4	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1622245	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CALML4 mRNA	CTD	PMID:36331819
Calml4	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1622245	6480464	ethylene dichloride results in decreased expression of CALML4 mRNA	CTD	PMID:28960355
Calml4	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1622245	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CALML4 mRNA	CTD	PMID:22206623
Calml4	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1622245	6480464	Ethinyl Estradiol results in increased expression of CALML4 mRNA	CTD	PMID:17942748
Calml4	Rat	17alpha-ethynylestradiol	decreases expression	EXP		6480464	Ethinyl Estradiol results in decreased expression of CALML4 mRNA	CTD	PMID:29097150
Calml4	Rat	17beta-estradiol	decreases expression	ISO	RGD:1344788	6480464	Estradiol results in decreased expression of CALML4 mRNA	CTD	PMID:20106945
Calml4	Rat	17beta-estradiol	increases expression	ISO	RGD:1622245	6480464	Estradiol results in increased expression of CALML4 mRNA	CTD	PMID:19484750
Calml4	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1622245	6480464	Tetrachlorodibenzodioxin inhibits the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] more ...	CTD	PMID:16054899
Calml4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1622245	6480464	Tetrachlorodibenzodioxin results in decreased expression of CALML4 mRNA	CTD	PMID:33956508
Calml4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1622245	6480464	Tetrachlorodibenzodioxin affects the expression of CALML4 mRNA	CTD	PMID:21570461\|PMID:26377647
Calml4	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1344788	6480464	[Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CALML4 mRNA	CTD	PMID:26159488
Calml4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of CALML4 mRNA	CTD	PMID:22298810
Calml4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1344788	6480464	Tetrachlorodibenzodioxin results in decreased expression of CALML4 mRNA	CTD	PMID:20106945
Calml4	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:1622245	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of CALML4 mRNA	CTD	PMID:26251327
Calml4	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1622245	6480464	[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression more ...	CTD	PMID:16054899
Calml4	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1344788	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Calml4	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1622245	6480464	bisphenol S results in increased expression of CALML4 mRNA	CTD	PMID:30951980
Calml4	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1622245	6480464	Fenretinide results in increased expression of CALML4 mRNA	CTD	PMID:28973697
Calml4	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1622245	6480464	Fenretinide results in decreased expression of CALML4 mRNA	CTD	PMID:28973697
Calml4	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of CALML4 mRNA	CTD	PMID:24780913
Calml4	Rat	6-propyl-2-thiouracil	multiple interactions	ISO	RGD:1622245	6480464	[Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of CALML4 mRNA	CTD	PMID:36706583
Calml4	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of CALML4 mRNA	CTD	PMID:30047161
Calml4	Rat	acrylamide	decreases expression	ISO	RGD:1622245	6480464	Acrylamide results in decreased expression of CALML4 mRNA	CTD	PMID:35032568
Calml4	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1344788	6480464	Tretinoin results in decreased expression of CALML4 mRNA	CTD	PMID:33167477
Calml4	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CALML4 mRNA	CTD	PMID:35163327
Calml4	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of CALML4 mRNA	CTD	PMID:38685447
Calml4	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of CALML4 mRNA	CTD	PMID:30047161
Calml4	Rat	atrazine	increases expression	ISO	RGD:1344788	6480464	Atrazine results in increased expression of CALML4 mRNA	CTD	PMID:22378314
Calml4	Rat	belinostat	decreases expression	ISO	RGD:1344788	6480464	belinostat results in decreased expression of CALML4 mRNA	CTD	PMID:26272509\|PMID:27188386
Calml4	Rat	belinostat	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Calml4	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1622245	6480464	AHR protein affects the reaction [Benzo(a)pyrene affects the expression of CALML4 mRNA]	CTD	PMID:22228805
Calml4	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1344788	6480464	Benzo(a)pyrene results in decreased expression of CALML4 mRNA	CTD	PMID:32234424
Calml4	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1344788	6480464	Benzo(a)pyrene affects the methylation of CALML4 exon	CTD	PMID:27901495
Calml4	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1344788	6480464	Benzo(a)pyrene results in decreased methylation of CALML4 3' UTR; Benzo(a)pyrene results in decreased methylation of more ...	CTD	PMID:27901495
Calml4	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1622245	6480464	Benzo(a)pyrene results in increased expression of CALML4 mRNA	CTD	PMID:27195522
Calml4	Rat	beta-lapachone	decreases expression	ISO	RGD:1344788	6480464	beta-lapachone results in decreased expression of CALML4 mRNA	CTD	PMID:38218311
Calml4	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of CALML4 mRNA	CTD	PMID:25181051
Calml4	Rat	bisphenol A	increases expression	ISO	RGD:1622245	6480464	bisphenol A results in increased expression of CALML4 mRNA	CTD	PMID:30951980\|PMID:32156529
Calml4	Rat	bisphenol A	multiple interactions	ISO	RGD:1344788	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Calml4	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of CALML4 mRNA	CTD	PMID:29097150\|PMID:34947998
Calml4	Rat	bisphenol F	multiple interactions	ISO	RGD:1344788	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Calml4	Rat	bisphenol F	increases expression	ISO	RGD:1622245	6480464	bisphenol F results in increased expression of CALML4 mRNA	CTD	PMID:30951980
Calml4	Rat	carbon nanotube	decreases expression	ISO	RGD:1622245	6480464	Nanotubes, Carbon analog results in decreased expression of CALML4 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
Calml4	Rat	carbon nanotube	increases expression	ISO	RGD:1622245	6480464	Nanotubes, Carbon results in increased expression of CALML4 mRNA	CTD	PMID:25620056
Calml4	Rat	choline	multiple interactions	ISO	RGD:1622245	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Calml4	Rat	ciguatoxin CTX1B	affects expression	ISO	RGD:1622245	6480464	Ciguatoxins affects the expression of CALML4 mRNA	CTD	PMID:18353800
Calml4	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of CALML4 mRNA	CTD	PMID:24386269
Calml4	Rat	copper atom	multiple interactions	ISO	RGD:1344788	6480464	[NSC 689534 binds to Copper] which results in decreased expression of CALML4 mRNA	CTD	PMID:20971185
Calml4	Rat	copper(0)	multiple interactions	ISO	RGD:1344788	6480464	[NSC 689534 binds to Copper] which results in decreased expression of CALML4 mRNA	CTD	PMID:20971185
Calml4	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1344788	6480464	Copper Sulfate results in decreased expression of CALML4 mRNA	CTD	PMID:19549813
Calml4	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of CALML4 mRNA	CTD	PMID:26577399
Calml4	Rat	cyclosporin A	decreases expression	ISO	RGD:1344788	6480464	Cyclosporine results in decreased expression of CALML4 mRNA	CTD	PMID:20106945\|PMID:25562108\|PMID:27989131
Calml4	Rat	dexamethasone	multiple interactions	ISO	RGD:1622245	6480464	[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression more ...	CTD	PMID:16054899
Calml4	Rat	dexamethasone	multiple interactions	ISO	RGD:1344788	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Calml4	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of CALML4 mRNA	CTD	PMID:21266533
Calml4	Rat	dicrotophos	decreases expression	ISO	RGD:1344788	6480464	dicrotophos results in decreased expression of CALML4 mRNA	CTD	PMID:28302478
Calml4	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of CALML4 mRNA	CTD	PMID:36653537
Calml4	Rat	diiodine	multiple interactions	ISO	RGD:1622245	6480464	[Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of CALML4 mRNA	CTD	PMID:36706583
Calml4	Rat	diuron	decreases expression	EXP		6480464	Diuron metabolite results in decreased expression of CALML4 mRNA	CTD	PMID:24172598
Calml4	Rat	dorsomorphin	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Calml4	Rat	endosulfan	multiple interactions	ISO	RGD:1344788	6480464	[Endosulfan co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CALML4 mRNA	CTD	PMID:26159488
Calml4	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of CALML4 mRNA	CTD	PMID:29391264
Calml4	Rat	entinostat	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Calml4	Rat	entinostat	decreases expression	ISO	RGD:1344788	6480464	entinostat results in decreased expression of CALML4 mRNA	CTD	PMID:26272509
Calml4	Rat	ethyl methanesulfonate	decreases expression	ISO	RGD:1344788	6480464	Ethyl Methanesulfonate results in decreased expression of CALML4 mRNA	CTD	PMID:23649840
Calml4	Rat	fipronil	increases expression	EXP		6480464	fipronil results in increased expression of CALML4 mRNA	CTD	PMID:23962444
Calml4	Rat	folic acid	multiple interactions	ISO	RGD:1622245	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CALML4 mRNA; [Methionine deficiency co-treated more ...	CTD	PMID:20938992\|PMID:22206623
Calml4	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of CALML4 mRNA	CTD	PMID:27387713
Calml4	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of CALML4 mRNA	CTD	PMID:33387578
Calml4	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of CALML4 mRNA	CTD	PMID:24395379
Calml4	Rat	glyphosate	decreases expression	EXP		6480464	Glyphosate results in decreased expression of CALML4 mRNA	CTD	PMID:38314887
Calml4	Rat	indometacin	multiple interactions	ISO	RGD:1344788	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Calml4	Rat	L-methionine	multiple interactions	ISO	RGD:1622245	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Calml4	Rat	lead(0)	affects expression	ISO	RGD:1344788	6480464	Lead affects the expression of CALML4 mRNA	CTD	PMID:22313790
Calml4	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of CALML4 mRNA	CTD	PMID:30047161
Calml4	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1344788	6480464	Methyl Methanesulfonate results in decreased expression of CALML4 mRNA	CTD	PMID:23649840
Calml4	Rat	methylmercury chloride	increases expression	ISO	RGD:1344788	6480464	methylmercuric chloride results in increased expression of CALML4 mRNA	CTD	PMID:28001369
Calml4	Rat	N(4)-hydroxycytidine	decreases expression	ISO	RGD:1622245	6480464	N(4)-hydroxycytidine results in decreased expression of CALML4 mRNA	CTD	PMID:37748715
Calml4	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:1622245	6480464	Diethylnitrosamine results in increased expression of CALML4 mRNA	CTD	PMID:24535843
Calml4	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:1622245	6480464	[Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of CALML4 mRNA	CTD	PMID:24535843
Calml4	Rat	O-methyleugenol	decreases expression	ISO	RGD:1344788	6480464	methyleugenol results in decreased expression of CALML4 mRNA	CTD	PMID:32234424
Calml4	Rat	okadaic acid	decreases expression	ISO	RGD:1344788	6480464	Okadaic Acid results in decreased expression of CALML4 mRNA	CTD	PMID:38832940
Calml4	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of CALML4 mRNA	CTD	PMID:25729387
Calml4	Rat	ozone	multiple interactions	ISO	RGD:1622245	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CALML4 more ...	CTD	PMID:34911549
Calml4	Rat	paracetamol	decreases expression	ISO	RGD:1344788	6480464	Acetaminophen results in decreased expression of CALML4 mRNA	CTD	PMID:22230336
Calml4	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of CALML4 mRNA	CTD	PMID:33387578
Calml4	Rat	perfluorononanoic acid	decreases expression	ISO	RGD:1344788	6480464	perfluoro-n-nonanoic acid results in decreased expression of CALML4 mRNA	CTD	PMID:32588087
Calml4	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1622245	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CALML4 mRNA	CTD	PMID:36331819
Calml4	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CALML4 mRNA	CTD	PMID:35163327
Calml4	Rat	phenobarbital	multiple interactions	ISO	RGD:1622245	6480464	[Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of CALML4 mRNA; NR1I3 protein affects the more ...	CTD	PMID:19482888\|PMID:24535843
Calml4	Rat	phenobarbital	affects expression	ISO	RGD:1622245	6480464	Phenobarbital affects the expression of CALML4 mRNA	CTD	PMID:23091169
Calml4	Rat	phenobarbital	affects expression	ISO	RGD:1344788	6480464	Phenobarbital affects the expression of CALML4 mRNA	CTD	PMID:19159669
Calml4	Rat	phenobarbital	increases expression	ISO	RGD:1622245	6480464	Phenobarbital results in increased expression of CALML4 mRNA	CTD	PMID:19482888
Calml4	Rat	phenylmercury acetate	decreases expression	ISO	RGD:1344788	6480464	Phenylmercuric Acetate results in decreased expression of CALML4 mRNA	CTD	PMID:26272509
Calml4	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Calml4	Rat	pirinixic acid	multiple interactions	ISO	RGD:1344788	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Calml4	Rat	pyrogallol	increases expression	ISO	RGD:1622245	6480464	Pyrogallol results in increased expression of CALML4 mRNA	CTD	PMID:20362636
Calml4	Rat	SB 431542	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Calml4	Rat	sodium arsenite	increases expression	ISO	RGD:1344788	6480464	sodium arsenite results in increased expression of CALML4 mRNA	CTD	PMID:28595984\|PMID:29301061
Calml4	Rat	sodium dichromate	affects expression	EXP		6480464	sodium bichromate affects the expression of CALML4 mRNA	CTD	PMID:22110744
Calml4	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of CALML4 mRNA	CTD	PMID:30047161
Calml4	Rat	tert-butyl hydroperoxide	increases expression	ISO	RGD:1622245	6480464	tert-Butylhydroperoxide results in increased expression of CALML4 mRNA	CTD	PMID:15003993
Calml4	Rat	tetrachloroethene	decreases expression	ISO	RGD:1622245	6480464	Tetrachloroethylene results in decreased expression of CALML4 mRNA	CTD	PMID:28973375
Calml4	Rat	tetrachloromethane	decreases expression	ISO	RGD:1622245	6480464	Carbon Tetrachloride results in decreased expression of CALML4 mRNA	CTD	PMID:17484886
Calml4	Rat	tetrachloromethane	increases expression	ISO	RGD:1622245	6480464	Carbon Tetrachloride results in increased expression of CALML4 mRNA	CTD	PMID:27339419\|PMID:31919559
Calml4	Rat	thimerosal	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with Thimerosal co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Calml4	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of CALML4 mRNA	CTD	PMID:34492290
Calml4	Rat	titanium dioxide	decreases expression	ISO	RGD:1622245	6480464	titanium dioxide results in decreased expression of CALML4 mRNA	CTD	PMID:23557971
Calml4	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of CALML4 mRNA	CTD	PMID:25729387
Calml4	Rat	tributylstannane	increases expression	ISO	RGD:1622245	6480464	tributyltin results in increased expression of CALML4 mRNA	CTD	PMID:31939706
Calml4	Rat	troglitazone	decreases expression	ISO	RGD:1344788	6480464	troglitazone results in decreased expression of CALML4 mRNA	CTD	PMID:25572481
Calml4	Rat	urethane	decreases expression	ISO	RGD:1344788	6480464	Urethane results in decreased expression of CALML4 mRNA	CTD	PMID:28818685
Calml4	Rat	valproic acid	increases methylation	ISO	RGD:1344788	6480464	Valproic Acid results in increased methylation of CALML4 gene	CTD	PMID:29154799
Calml4	Rat	valproic acid	affects expression	ISO	RGD:1344788	6480464	Valproic Acid affects the expression of CALML4 mRNA	CTD	PMID:25979313
Calml4	Rat	valproic acid	decreases expression	ISO	RGD:1622245	6480464	Valproic Acid results in decreased expression of CALML4 mRNA	CTD	PMID:24896083
Calml4	Rat	valproic acid	decreases expression	ISO	RGD:1344788	6480464	Valproic Acid results in decreased expression of CALML4 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:25192806\|PMID:26272509\|PMID:28001369
Calml4	Rat	valproic acid	multiple interactions	ISO	RGD:1344788	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Calml4	Rat	zoledronic acid	decreases expression	ISO	RGD:1344788	6480464	zoledronic acid results in decreased expression of CALML4 mRNA	CTD	PMID:20977926

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Calml4	Rat	brush border assembly	involved_in	ISO	RGD:1344788	1624291	PMID:32209652	RGD	PMID:32209652
Calml4	Rat	brush border assembly	involved_in	IEA	UniProtKB:Q96GE6\|ensembl:ENSP00000419081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Calml4	Rat	microtubule cytoskeleton organization	involved_in	IBA	FB:FBgn0000253\|PANTHER:PTN000549862\|PomBase:SPAC3A12.14\|SGD:S000000313\|WB:WBGene00000552	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Calml4	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0000253\|FB:FBgn0004910\|FB:FBgn0011273\|PANTHER:PTN000549861\|PomBase:SPAC29A4.05\|PomBase:SPAC3A12.14\|TAIR:locus:2034635\|TAIR:locus:2063245\|TAIR:locus:2075427\|TAIR:locus:2083700\|TAIR:locus:2103600\|TAIR:locus:2131458\|TAIR:locus:2162326\|UniProtKB:P04464\|UniProtKB:Q57YH4\|dictyBase:DDB_G0277917\|dictyBase:DDB_G0279407	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Calml4	Rat	microvillus	located_in	ISO	RGD:1344788	1624291	PMID:32209652	RGD	PMID:32209652
Calml4	Rat	microvillus	located_in	IEA	UniProtKB:Q96GE6\|ensembl:ENSP00000419081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Calml4	Rat	calcium ion binding	enables	IBA	FB:FBgn0000253\|FB:FBgn0004910\|MGI:1931464\|MGI:2677454\|PANTHER:PTN000549682\|PomBase:SPAC3A12.14\|RGD:2257\|RGD:2258\|RGD:2259\|SGD:S000000313\|TAIR:locus:2027488\|TAIR:locus:2063230\|TAIR:locus:2063245\|TAIR:locus:2074780\|TAIR:locus:2102340\|TAIR:locus:2162326\|UniProtKB:P04464\|UniProtKB:P0DP23\|UniProtKB:P0DP24\|UniProtKB:P0DP25\|UniProtKB:P60204\|UniProtKB:P62149\|UniProtKB:P62157\|dictyBase:DDB_G0277917\|dictyBase:DDB_G0279407	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Calml4	Rat	calcium ion binding	enables	IEA	InterPro:IPR002048	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Calml4	Rat	enzyme regulator activity	enables	IBA	PANTHER:PTN000549861\|PomBase:SPAC29A4.05\|dictyBase:DDB_G0279407	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Calml4	Rat	myosin head/neck binding	enables	ISO	RGD:1344788	1624291	UniProtKB:Q6PIF6 PMID:32209652	RGD	PMID:32209652
Calml4	Rat	myosin head/neck binding	enables	IEA	UniProtKB:Q96GE6\|ensembl:ENSP00000419081	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

neuronal ceroid lipofuscinosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP,ISO)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

atrazine (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (EXP)

diiodine (ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP,ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

fipronil (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glycidol (EXP)

glyphosate (EXP)

indometacin (ISO)

L-methionine (ISO)

lead(0) (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N(4)-hydroxycytidine (ISO)

N-nitrosodiethylamine (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pyrogallol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

tributylstannane (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brush border assembly (IEA,ISO)

microtubule cytoskeleton organization (IBA)

Cellular Component

cytoplasm (IBA)

microvillus (IEA,ISO)

Molecular Function

calcium ion binding (IBA,IEA)

enzyme regulator activity (IBA)

myosin head/neck binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Calml4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	72,218,870 - 72,230,650 (+)	NCBI		GRCr8
mRatBN7.2	8	63,323,426 - 63,335,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	63,323,351 - 63,335,234 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	68,838,506 - 68,850,149 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	67,110,960 - 67,122,603 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	64,980,956 - 64,992,609 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	67,753,279 - 67,765,359 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	67,753,279 - 67,765,358 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	67,007,122 - 67,018,886 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	62,738,382 - 62,750,146 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

CALML4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	68,190,705 - 68,206,110 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	68,190,705 - 68,206,079 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	68,483,043 - 68,498,448 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	66,270,097 - 66,285,502 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	66,270,479 - 66,285,502	NCBI
Celera	15	45,367,956 - 45,383,362 (-)	NCBI		Celera
Cytogenetic Map	15	q23	NCBI
HuRef	15	45,313,778 - 45,329,162 (-)	NCBI		HuRef
CHM1_1	15	68,600,995 - 68,616,402 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	66,009,455 - 66,024,859 (-)	NCBI		T2T-CHM13v2.0

Calml4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	62,765,068 - 62,783,203 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	62,765,362 - 62,783,203 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	62,857,472 - 62,875,921 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	62,858,080 - 62,875,921 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	62,705,911 - 62,723,725 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	62,656,110 - 62,673,924 (+)	NCBI		MGSCv36	mm8
Celera	9	60,083,497 - 60,094,995 (+)	NCBI		Celera
Cytogenetic Map	9	B	NCBI
cM Map	9	33.9	NCBI

Calml4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	7,887,414 - 7,894,143 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	7,886,565 - 7,894,143 (+)	NCBI	ChiLan1.0	ChiLan1.0

CALML4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	57,444,352 - 57,460,549 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	61,618,194 - 61,634,392 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	47,140,272 - 47,155,700 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	65,409,732 - 65,424,852 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	65,409,732 - 65,424,852 (-)	Ensembl	panpan1.1		panPan2

CALML4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	32,234,879 - 32,244,321 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	32,235,091 - 32,240,008 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	32,169,539 - 32,179,258 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	32,430,743 - 32,440,471 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	32,430,780 - 32,435,698 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	32,359,011 - 32,368,754 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	32,420,957 - 32,430,694 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	32,666,809 - 32,676,532 (-)	NCBI		UU_Cfam_GSD_1.0

Calml4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	110,210,102 - 110,222,226 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	28,058,176 - 28,067,442 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	28,058,165 - 28,067,463 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CALML4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	166,083,629 - 166,099,593 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	166,089,583 - 166,099,794 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

CALML4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	15,278,349 - 15,291,934 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	126,176,796 - 126,188,708 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Calml4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	4,882,136 - 4,888,358 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	4,880,142 - 4,892,829 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Calml4
26 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	147
Count of miRNA genes:	113
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000009716
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

Markers in Region

RH141552

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	63,334,888 - 63,335,079 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	67,765,013 - 67,765,203	NCBI	Rnor6.0
Rnor_5.0	8	67,493,760 - 67,493,950	UniSTS	Rnor5.0
RGSC_v3.4	8	67,018,541 - 67,018,731	UniSTS	RGSC3.4
Celera	8	62,749,801 - 62,749,991	UniSTS
RH 3.4 Map	8	792.2	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001127575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006243243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC158759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009716 ⟹ ENSRNOP00000009716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	63,323,351 - 63,335,234 (+)	Ensembl
Rnor_6.0 Ensembl	8	67,753,279 - 67,765,358 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106596 ⟹ ENSRNOP00000079478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	63,323,461 - 63,334,789 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109828 ⟹ ENSRNOP00000083397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	63,323,469 - 63,335,234 (+)	Ensembl

RefSeq Acc Id:

NM_001127575 ⟹ NP_001121047

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	72,218,886 - 72,230,650 (+)	NCBI
mRatBN7.2	8	63,323,469 - 63,335,234 (+)	NCBI
Rnor_6.0	8	67,753,279 - 67,765,358 (+)	NCBI
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI
RGSC_v3.4	8	67,007,122 - 67,018,886 (+)	RGD
Celera	8	62,738,382 - 62,750,146 (+)	RGD

Sequence:

show sequence

ATTTATTACCAGGCCTCCACCCAGCCTGGTGGACTTTCGACTCCAAGCCGGAGTAAAGAGAACC
AAACACAGTTCCAGGAGCCAGGGGTGCCTGAGGATGGCCAAGTTCCTTTCCCAGGAGCAAATTA
ATGAGTACAAGGAATGCTTCTCCCTGTATGACAAGCAGCAAAGAGGGAAGATTAAGGCCACAGA
TCTCCTGGTGTCCATGAGGTGCCTGGGGGCCAGCCCCACACCTGGGGAAGTGCAGCGGCACCTG
CAGACTCATGGAATAGACAAGAACGGAGAACTGGATTTCTCCACCTTCCTGACCATTATGCACA
TGCAAATCAAGCAAGAGGACCCAAAGAAAGAAATCCTTCTGGCCATGCTGATGACAGACAAGGA
GAAGAAAGGTTACATCATGGCGTCTGAGTTGCGGTCGAAACTCATGAAACTGGGAGAGAAGCTC
ACTCACAAAGAAGTGGATGAGCTTTTCAAGGAAGCGGGCATCGAACCTAACGGCCAAGTGAAAT
ATGACACGTTTATCCAGAGGATCACCCTGCCCGTGCGAGACTACTAGGGAGCCGAGGTCAAGGG
AGCAGAGGATGACAGCCTCCGGGGCCTGAAAACCTGGACTGAAGGTTTTTGTAAGGGAAGTCTA
GAGATGGCGAACACAGCAGTAAGACCACATGGCACAACCCCTGCAGGGGGTGAATACCAATAAA
TGATGTGGCCATGTACTGGTTGCCTGTAAGAGGAGGTCTGTCTGGATTTCCGTACTAACATTAC
CCAGCCCTTTGCAGCATGGACGGGCTGCCTCTGCAACGTCATCCCCCTCACCCACTGTACTTCT
CAAAGCCTTTGGACCTCACAAAGATGACGATGATGACTTGAAAATAAATGCGTGGCAACTCAAG

hide sequence

RefSeq Acc Id:

XM_006243243 ⟹ XP_006243305

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	72,218,870 - 72,230,649 (+)	NCBI
mRatBN7.2	8	63,323,451 - 63,335,233 (+)	NCBI
Rnor_6.0	8	67,753,298 - 67,765,359 (+)	NCBI
Rnor_5.0	8	67,482,026 - 67,494,105 (+)	NCBI

Sequence:

show sequence

CCCAGCCTGGTGGACTTTCGACTCCAAGCCGGAGTAAAGAGAACCAAACACAGTTCCAGGAGCC
AGGGGTGCCTGAGGATGAGTACAAGGAATGCTTCTCCCTGTATGACAAGCAGCAAAGAGGGAAG
ATTAAGGCCACAGATCTCCTGGTGTCCATGAGGTGCCTGGGGGCCAGCCCCACACCTGGGGAAG
TGCAGCGGCACCTGCAGACTCATGGAATAGACAAGAACGGAGAACTGGATTTCTCCACCTTCCT
GACCATTATGCACATGCAAATCAAGCAAGAGGACCCAAAGAAAGAAATCCTTCTGGCCATGCTG
ATGACAGACAAGGAGAAGAAAGGTTACATCATGGCGTCTGAGTTGCGGTCGAAACTCATGAAAC
TGGGAGAGAAGCTCACTCACAAAGAAGTGGATGAGCTTTTCAAGGAAGCGGGCATCGAACCTAA
CGGCCAAGTGAAATATGACACGTTTATCCAGAGGATCACCCTGCCCGTGCGAGACTACTAGGGA
GCCGAGGTCAAGGGAGCAGAGGATGACAGCCTCCGGGGCCTGAAAACCTGGACTGAAGGTTTTT
GTAAGGGAAGTCTAGAGATGGCGAACACAGCAGTAAGACCACATGGCACAACCCCTGCAGGGGG
TGAATACCAATAAATGATGTGGCCATGTACTGGTTGCCTGTAAGAGGAGGTCTGTCTGGATTTC
CGTACTAACATTACCCAGCCCTTTGCAGCATGGACGGGCTGCCTCTGCAACGTCATCCCCCTCA
CCCACTGTACTTCTCAAAGCCTTTGGACCTCACAAAGATGACGATGATGACTTGAAAATAAATG
CGTGGCAACTCAAGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001121047	(Get FASTA)	NCBI Sequence Viewer
	XP_006243305	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58760	(Get FASTA)	NCBI Sequence Viewer
	EDL95761	(Get FASTA)	NCBI Sequence Viewer
	EDL95762	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009716.6
	ENSRNOP00000079478.1
	ENSRNOP00000083397.1

RefSeq Acc Id:	NP_001121047 ⟸ NM_001127575
- UniProtKB:	B0BNB8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAKFLSQEQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGEL DFSTFLTIMHMQIKQEDPKKEILLAMLMTDKEKKGYIMASELRSKLMKLGEKLTHKEVDELFKE AGIEPNGQVKYDTFIQRITLPVRDY hide sequence

RefSeq Acc Id:	XP_006243305 ⟸ XM_006243243
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5ZX47 (UniProtKB/TrEMBL), A6J589 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRCLGASPTPGEVQRHLQTHGIDKNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMTDKEKKGY IMASELRSKLMKLGEKLTHKEVDELFKEAGIEPNGQVKYDTFIQRITLPVRDY hide sequence

Ensembl Acc Id:

ENSRNOP00000009716 ⟸ ENSRNOT00000009716

Ensembl Acc Id:

ENSRNOP00000083397 ⟸ ENSRNOT00000109828

Ensembl Acc Id:

ENSRNOP00000079478 ⟸ ENSRNOT00000106596

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BNB8-F1-model_v2	AlphaFold	B0BNB8	1-153	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696056

Promoter ID:

EPDNEW_R6581

Type:

initiation region

Name:

Calml4_1

Description:

calmodulin-like 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	67,753,309 - 67,753,369	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583918	AgrOrtholog
BioCyc Gene	G2FUF-30147	BioCyc
Ensembl Genes	ENSRNOG00000038202	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009716.6	UniProtKB/TrEMBL
	ENSRNOT00000106596.1	UniProtKB/TrEMBL
	ENSRNOT00000109828.1	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7099908	IMAGE-MGC_LOAD
InterPro	Ca-Reg_Muscle_Contr_Cell_Proc	UniProtKB/TrEMBL
	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
KEGG Report	rno:691455	UniProtKB/TrEMBL
MGC_CLONE	MGC:187971	IMAGE-MGC_LOAD
NCBI Gene	691455	ENTREZGENE
PANTHER	CALMODULIN LIKE 4	UniProtKB/TrEMBL
	MYOSIN LIGHT CHAIN 1, 3	UniProtKB/TrEMBL
Pfam	EF-hand_8	UniProtKB/TrEMBL
	EF_hand_5	UniProtKB/TrEMBL
PhenoGen	Calml4	PhenoGen
PROSITE	EF_HAND_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000038202	RatGTEx
SMART	EFh	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A0A8I5ZX47	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G3C9_RAT	UniProtKB/TrEMBL
	A6J589	ENTREZGENE, UniProtKB/TrEMBL
	B0BNB8	ENTREZGENE, UniProtKB/TrEMBL
	F7F9Q8_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Calml4	calmodulin-like 4	LOC691455	similar to calmodulin-like 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC691455	similar to calmodulin-like 4	LOC686783	similar to calmodulin-like 4	Data merged from RGD:1593679	1643240	APPROVED
2006-11-20	LOC686783	similar to calmodulin-like 4			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC691455	similar to calmodulin-like 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar