Glipr2 (GLI pathogenesis-related 2)

Advanced Search (OLGA)

Gene: Glipr2 (GLI pathogenesis-related 2) Rattus norvegicus

Analyze

Symbol:

Glipr2

Name:

GLI pathogenesis-related 2

RGD ID:

1583669

Description:

Predicted to enable protein homodimerization activity. Predicted to be involved in positive regulation of ERK1 and ERK2 cascade; positive regulation of epithelial cell migration; and positive regulation of epithelial to mesenchymal transition. Predicted to be located in Golgi membrane. Predicted to be active in extracellular space. Orthologous to human GLIPR2 (GLI pathogenesis related 2); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Golgi-associated plant pathogenesis-related protein 1; LOC679819; similar to GLI pathogenesis-related 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GLIPR2 (GLI pathogenesis related 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Glipr2 (GLI pathogenesis-related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Glipr2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GLIPR2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GLIPR2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Glipr2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GLIPR2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GLIPR2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Glipr2 (GLI pathogenesis related 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CCS (copper chaperone for superoxide dismutase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GLIPR2 (GLI pathogenesis related 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Glipr2 (GLI pathogenesis-related 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	glipr2l (GLI pathogenesis-related 2, like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	F09B9.5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRY1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRY2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PRY3	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG31482	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	glipr2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,966,163 - 62,998,016 (+)	NCBI		GRCr8
mRatBN7.2	5	58,170,417 - 58,202,258 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,170,425 - 58,202,272 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	60,162,491 - 60,183,102 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,981,302 - 62,001,915 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,951,795 - 61,972,315 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,415,415 - 59,446,732 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,416,076 - 59,446,647 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,939,323 - 63,969,256 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	60,419,965 - 60,439,957 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	56,749,702 - 56,779,535 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

anauxetic dysplasia (ISO)

autosomal recessive distal hereditary motor neuronopathy 2 (ISO)

distal arthrogryposis type 1A (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis 6 (ISO)

galactosemia (ISO)

hyperphosphatasia with impaired intellectual development syndrome 2 (ISO)

pancreatic ductal adenocarcinoma (ISO)

paraplegia (ISO)

primary ciliary dyskinesia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3',5'-cyclic AMP (EXP)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

butan-1-ol (ISO)

butanal (ISO)

calcitriol (ISO)

camptothecin (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dioxygen (ISO)

diuron (ISO)

dorsomorphin (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

GW 4064 (ISO)

isobutanol (ISO)

L-methionine (ISO)

lead diacetate (ISO)

lead(0) (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

Nutlin-3 (ISO)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

pirinixic acid (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propanal (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of epithelial cell migration (ISO)

positive regulation of epithelial to mesenchymal transition (ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

Cellular Component

extracellular space (IBA)

Golgi membrane (ISO)

Molecular Function

protein homodimerization activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	PSMD11, PTPRM and PTPRB as novel biomarkers of pancreatic cancer progression.	Sahni S, etal., Biochim Biophys Acta Gen Subj. 2020 Nov;1864(11):129682. doi: 10.1016/j.bbagen.2020.129682. Epub 2020 Jul 12.

Additional References at PubMed

PMID:11865038	PMID:15123429	PMID:18570454	PMID:19056867	PMID:23376485	PMID:23516513	PMID:23533145	PMID:35352799

Genomics

Comparative Map Data

Glipr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,966,163 - 62,998,016 (+)	NCBI		GRCr8
mRatBN7.2	5	58,170,417 - 58,202,258 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,170,425 - 58,202,272 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	60,162,491 - 60,183,102 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,981,302 - 62,001,915 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,951,795 - 61,972,315 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,415,415 - 59,446,732 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,416,076 - 59,446,647 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,939,323 - 63,969,256 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	60,419,965 - 60,439,957 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	56,749,702 - 56,779,535 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

GLIPR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	36,136,536 - 36,163,913 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	36,136,536 - 36,163,913 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	36,136,533 - 36,163,910 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	36,126,742 - 36,153,903 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	36,126,741 - 36,153,901	NCBI
Celera	9	36,070,326 - 36,097,488 (+)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	36,101,693 - 36,117,808 (+)	NCBI		HuRef
CHM1_1	9	36,137,143 - 36,164,306 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	36,158,540 - 36,185,919 (+)	NCBI		T2T-CHM13v2.0

Glipr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,957,702 - 43,979,118 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,957,401 - 43,979,118 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	43,957,702 - 43,979,118 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,957,401 - 43,979,118 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	43,970,574 - 43,991,990 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,978,802 - 44,000,218 (+)	NCBI		MGSCv36	mm8
Celera	4	43,978,792 - 44,000,334 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	23.07	NCBI

Glipr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	189,858 - 201,549 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	191,886 - 201,551 (-)	NCBI	ChiLan1.0	ChiLan1.0

GLIPR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	88,425,634 - 88,452,830 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	88,431,567 - 88,458,767 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	35,986,341 - 36,013,662 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	36,787,649 - 36,814,812 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	36,787,649 - 36,814,812 (+)	Ensembl	panpan1.1		panPan2

GLIPR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	52,622,460 - 52,634,602 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	52,615,039 - 52,681,270 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	51,205,566 - 51,225,284 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	53,721,186 - 53,740,908 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	53,625,498 - 53,790,061 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	52,224,123 - 52,243,829 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	52,246,168 - 52,265,881 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	52,947,714 - 52,967,435 (+)	NCBI		UU_Cfam_GSD_1.0

Glipr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	167,571,564 - 167,592,321 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	4,118,697 - 4,139,942 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	4,118,964 - 4,139,901 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GLIPR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	236,919,879 - 236,943,823 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	236,919,821 - 236,943,828 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	264,627,079 - 264,651,269 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GLIPR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	44,395,343 - 44,422,118 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	44,395,321 - 44,422,092 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	41,486,310 - 41,513,121 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Glipr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624868	4,546,030 - 4,566,817 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624868	4,546,150 - 4,566,782 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Glipr2
301 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	101
Count of miRNA genes:	86
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000019916
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat

Markers in Region

D5Got228

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	58,194,753 - 58,194,956 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	59,440,311 - 59,440,511	NCBI	Rnor6.0
Rnor_5.0	5	63,962,990 - 63,963,190	UniSTS	Rnor5.0
RGSC_v3.4	5	60,433,732 - 60,433,932	UniSTS	RGSC3.4
Celera	5	56,773,293 - 56,773,493	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001398957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_002726512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006225276	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC127935	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC133832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019916 ⟹ ENSRNOP00000019916

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,170,425 - 58,202,085 (+)	Ensembl
Rnor_6.0 Ensembl	5	59,416,076 - 59,446,647 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100825 ⟹ ENSRNOP00000078239

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,170,425 - 58,202,272 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117762 ⟹ ENSRNOP00000076449

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,181,647 - 58,202,085 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118387 ⟹ ENSRNOP00000085577

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,181,708 - 58,202,085 (+)	Ensembl

RefSeq Acc Id:

NM_001398957 ⟹ NP_001385886

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	62,977,397 - 62,998,009 (+)	NCBI
mRatBN7.2	5	58,181,639 - 58,202,258 (+)	NCBI

RefSeq Acc Id:

XM_006238140 ⟹ XP_006238202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	62,966,163 - 62,998,016 (+)	NCBI
mRatBN7.2	5	58,170,417 - 58,200,947 (+)	NCBI
Rnor_6.0	5	59,415,415 - 59,446,732 (+)	NCBI
Rnor_5.0	5	63,939,323 - 63,969,256 (+)	NCBI

Sequence:

show sequence

AGTGCATTTGGGGACAGAGGACTTTACAGTGTGGGGGTGTGCGGTCTCTTGATGAAGACCTGCC
TAATTCCATCCCTTACTTCAGATAAGCGTGGGACAACCCTATCATGTCCCTGGCCCCCACCCAG
AGCCGCAGCTCTTTTCAATGCTGTCTCATTGCTGTATCCTTACAGAAGGGAGAAAGACCCAGAC
CCACAGCTGCCCCATGAGTCTCCACCCAAGTGCCAGTCATTTCTGCTATATTTTAGTGGCCAGT
GAAAGTCACGTGACTGTTCCTAAGCCCAAGTTCTGGGCAGAATATAAAGTACCCCGTGGTGGTG
GTTCTGTGTCTTGGGAAGAGGTTATGAGTATTTTAAACGATGCAGTTCTCATGAGGACAGACAA
GCCAGGACTGACTGGGTTTCTATTGGGAAGGTGGGTATGGTATGTTATGACCTGGAAGTCCAGT
GGGGTTTGGGTGAGGGAATATAAGAATGGAGATATCTAAAGTTGATCCCATCCTGAGAATATCA
TCACAACCCCCAAATGGTGATAGAATCAGGGTAGCTTGGGATAATATCCCCAAAGGCCCCGGTG
CTAAAGTGGACATCCAGCTACCTCAAGCACAGATCATAATGGCTTCCCAGCAACCAAGCTAGTG
GAGCTCTTGCTGGAACACCGCACCTCTACCCCAGCAGTGATCTTGAGATCCACAGGCAGAGACG
TAAGCTGAGTGGGCACTGCTGTGCCCTGGAGCCTACCCAAGCAGGGAACACCTGAGAATGCAGG
GGAAAGGCCTTCTGCAGGAGGAAGACAGGTTGGCTGAGGTGCAGCTTTTGTTACAGCCCAGGTT
TCCAGCAATAATAAAGAGTGATATCAAGCCTGCCCAGCATGATGAAGGCCTCATCTGTCAAGAA
CGATCAGAGTAATAACAGTGACGAAATGTGGCAAGCTTCCAAACAGTTTAATAATGAGGTCCTG
AAGGCCCACAACGAGTACCGGGCCAAGCATGGTGTCCCGCCACTGAAGCTCTGTAAGAAGCTCA
ACCAGGAAGCTCAGCAGTATTCAGAAGCCCTGGCCAGCACAAGAATTCTCAAACACAGCCCAGA
GTCCAGTCGTGGCCAGTGTGGGGAGAACCTTGCATGGGCATCCTACGATCAGACAGGAAAGGAA
GTGGCTGACAGGTGGTACAGTGAAATCAAGAGCTACAACTTCCAGCAGCCGGGTTTCACCTCAG
GGACCGGCCACTTCACAGCCATGGTGTGGAAGAATACCAAGAAGATAGGCGTGGGGAAGGCGTC
TGCGAGTGACGGGTCCTCCTTTGTGGTAGCCAGATACTTTCCAGCGGGGAATATTGTCAACCAG
GGCTTCTTTGAAGAGAATGTCCCACCTCCAAAGAAGTAACTAACACCACCAAACGTAATGAGAT
GGAGACGCATTTACCAAGTGCCTGTTGAACCACAAAAAGCCAGGAAGTGTCTGTCCCTGGGGTG
TATGTACTTCTGTGTTTACCTGTGAGCATCTCCTGTGACAGCTGCACTTGAGCTCATTCTGATT
AAAGGAGGGGCATCCGAAACATTTATCCAGAAGGTTAGCTAGACCGTAATTACTCAGACTACGT
AAGATTAATTCTGATATCTTTTTTCTGGTTTTAGTTTAGTTTTTTGTTTTTTGTTTTTTGTTTT
TT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001385886	(Get FASTA)	NCBI Sequence Viewer
	XP_006238202	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98781	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019916.6
	ENSRNOP00000076449.1
	ENSRNOP00000078239.1
	ENSRNOP00000085577.1

RefSeq Acc Id:	XP_006238202 ⟸ XM_006238140
- Peptide Label:	isoform X1
- UniProtKB:	F1M5V2 (UniProtKB/TrEMBL), A0A8I5ZKH6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMKASSVKNDQSNNSDEMWQASKQFNNEVLKAHNEYRAKHGVPPLKLCKKLNQEAQQYSEALAS TRILKHSPESSRGQCGENLAWASYDQTGKEVADRWYSEIKSYNFQQPGFTSGTGHFTAMVWKNT KKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPPPKK hide sequence

Ensembl Acc Id:

ENSRNOP00000019916 ⟸ ENSRNOT00000019916

Ensembl Acc Id:

ENSRNOP00000076449 ⟸ ENSRNOT00000117762

Ensembl Acc Id:

ENSRNOP00000085577 ⟸ ENSRNOT00000118387

Ensembl Acc Id:

ENSRNOP00000078239 ⟸ ENSRNOT00000100825

RefSeq Acc Id:	NP_001385886 ⟸ NM_001398957
- UniProtKB:	A0A8I5ZJ62 (UniProtKB/TrEMBL), A0A8I5ZKH6 (UniProtKB/TrEMBL), A6IJ61 (UniProtKB/TrEMBL)

Protein Domains

SCP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M5V2-F1-model_v2	AlphaFold	F1M5V2	1-170	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693689

Promoter ID:

EPDNEW_R4210

Type:

single initiation site

Name:

Glipr2_1

Description:

GLI pathogenesis-related 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	59,416,090 - 59,416,150	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583669	AgrOrtholog
BioCyc Gene	G2FUF-41481	BioCyc
Ensembl Genes	ENSRNOG00000014838	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000019916.8	UniProtKB/TrEMBL
	ENSRNOT00000100825.1	UniProtKB/TrEMBL
	ENSRNOT00000117762.1	UniProtKB/TrEMBL
	ENSRNOT00000118387.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.33.10	UniProtKB/TrEMBL
InterPro	Allrgn_V5/Tpx1	UniProtKB/TrEMBL
	Allrgn_V5/Tpx1_CS	UniProtKB/TrEMBL
	CAP_domain	UniProtKB/TrEMBL
	CAP_sf	UniProtKB/TrEMBL
	SCP_GAPR1-like	UniProtKB/TrEMBL
	V5_allergen-like	UniProtKB/TrEMBL
NCBI Gene	679819	ENTREZGENE
PANTHER	Allrgn_V5/Tpx1	UniProtKB/TrEMBL
	GOLGI-ASSOCIATED PLANT PATHOGENESIS-RELATED PROTEIN 1	UniProtKB/TrEMBL
Pfam	CAP	UniProtKB/TrEMBL
PhenoGen	Glipr2	PhenoGen
PRINTS	V5ALLERGEN	UniProtKB/TrEMBL
	V5TPXLIKE	UniProtKB/TrEMBL
PROSITE	CRISP_1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014838	RatGTEx
SMART	SCP	UniProtKB/TrEMBL
Superfamily-SCOP	SCP-like_extracellular	UniProtKB/TrEMBL
UniProt	A0A8I5ZJ62	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZKH6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A4D0_RAT	UniProtKB/TrEMBL
	A6IJ61	ENTREZGENE, UniProtKB/TrEMBL
	F1M5V2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-05	Glipr2	GLI pathogenesis-related 2	LOC679819	similar to GLI pathogenesis-related 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC679819	similar to GLI pathogenesis-related 2	LOC684484	similar to GLI pathogenesis-related 2	Data merged from RGD:1590283	1643240	APPROVED
2006-11-20	LOC684484	similar to GLI pathogenesis-related 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC679819	similar to GLI pathogenesis-related 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar