Tnfrsf18 (TNF receptor superfamily member 18)

Advanced Search (OLGA)

Gene: Tnfrsf18 (TNF receptor superfamily member 18) Rattus norvegicus

Analyze

Symbol:

Tnfrsf18

Name:

TNF receptor superfamily member 18

RGD ID:

1565872

Description:

Predicted to enable tumor necrosis factor receptor activity. Predicted to be involved in positive regulation of cell adhesion; positive regulation of leukocyte migration; and positive regulation of tyrosine phosphorylation of STAT protein. Predicted to be active in external side of plasma membrane. Orthologous to human TNFRSF18 (TNF receptor superfamily member 18); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC500598; similar to tumor necrosis factor receptor superfamily, member 18; tumor necrosis factor receptor superfamily member 18; tumor necrosis factor receptor superfamily, member 18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,901,734 - 171,904,578 (+)	NCBI		GRCr8
mRatBN7.2	5	166,618,461 - 166,622,353 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,618,969 - 166,622,353 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,323,289 - 169,325,887 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,144,711 - 171,147,309 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	171,107,243 - 171,109,841 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,459,371 - 173,463,980 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,460,354 - 173,463,140 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	176,933,400 - 176,938,350 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	172,869,196 - 172,871,795 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	164,820,612 - 164,823,210 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anogenital venereal wart (ISO)

chromosome 1p36 deletion syndrome (ISO)

congenital myasthenic syndrome 8 (ISO)

dilated cardiomyopathy 1LL (ISO)

Ehlers-Danlos syndrome spondylodysplastic type 2 (ISO)

Goldberg-Shprintzen syndrome (ISO)

immunodeficiency 16 (ISO)

immunodeficiency 38 (ISO)

Joubert syndrome 25 (ISO)

leishmaniasis (ISO)

Neurodevelopmental Disorders (ISO)

Peroxisome Biogenesis Disorder, Complementation Group 7 (ISO)

Shprintzen-Goldberg Craniosynostosis (ISO)

tropical spastic paraparesis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

acetamide (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cocaine (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

epoxiconazole (ISO)

fulvestrant (ISO)

lipopolysaccharide (ISO)

N-nitrosodiethylamine (ISO)

paracetamol (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium stibogluconate (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of apoptotic process (IEA)

positive regulation of cell adhesion (IBA,ISO)

positive regulation of leukocyte migration (ISO)

positive regulation of tyrosine phosphorylation of STAT protein (IEA,ISO)

tumor necrosis factor-mediated signaling pathway (IEA)

Cellular Component

external side of plasma membrane (IBA,ISO)

Molecular Function

protein binding (ISO)

tumor necrosis factor receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Evaluation of T Regulatory Lymphocytes Transcription Factors in HTLV-1-Associated Myelopathy/Tropical Spastic Paraparesis (HAM/TSP) Patients.	Ghezeldasht SA, etal., Appl Biochem Biotechnol. 2017 Aug;182(4):1403-1414. doi: 10.1007/s12010-017-2406-7. Epub 2017 Jan 18.
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	In vivo fluctuation of Tax, Foxp3, CTLA-4, and GITR mRNA expression in CD4(+)CD25(+) T cells of patients with human T-lymphotropic virus type 1-associated myelopathy.	Ramirez E, etal., Braz J Med Biol Res. 2010 Nov;43(11):1109-15. doi: 10.1590/s0100-879x2010007500107. Epub 2010 Oct 8.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Mechanistic investigation of immunosuppression in patients with condyloma acuminata.	Shi YJ, etal., Mol Med Rep. 2013 Aug;8(2):480-6. doi: 10.3892/mmr.2013.1511. Epub 2013 Jun 6.
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:16227984	PMID:16769892	PMID:23892569

Genomics

Comparative Map Data

Tnfrsf18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	171,901,734 - 171,904,578 (+)	NCBI		GRCr8
mRatBN7.2	5	166,618,461 - 166,622,353 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	166,618,969 - 166,622,353 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	169,323,289 - 169,325,887 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	171,144,711 - 171,147,309 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	171,107,243 - 171,109,841 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	173,459,371 - 173,463,980 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	173,460,354 - 173,463,140 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	176,933,400 - 176,938,350 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	172,869,196 - 172,871,795 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	164,820,612 - 164,823,210 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

TNFRSF18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	1,203,508 - 1,206,592 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	1,203,508 - 1,206,592 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	1,138,888 - 1,141,972 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	1,128,751 - 1,131,952 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	1,441,567 - 1,444,768 (+)	NCBI		Celera
Cytogenetic Map	1	p36.33	NCBI
HuRef	1	410,603 - 413,804 (-)	NCBI		HuRef
CHM1_1	1	1,125,362 - 1,128,563 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	631,965 - 635,049 (-)	NCBI		T2T-CHM13v2.0

Tnfrsf18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	156,110,779 - 156,113,351 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	156,110,621 - 156,113,352 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	156,026,322 - 156,028,894 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	156,026,164 - 156,028,895 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	155,400,451 - 155,403,000 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	154,870,142 - 154,872,691 (+)	NCBI		MGSCv36	mm8
Celera	4	158,288,886 - 158,291,431 (+)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI
cM Map	4	87.76	NCBI

Tnfrsf18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	9,571,530 - 9,573,733 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	9,571,527 - 9,573,733 (+)	NCBI	ChiLan1.0	ChiLan1.0

TNFRSF18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	227,018,219 - 227,022,812 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	225,714,938 - 225,719,522 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	1	1,160,540 - 1,163,839 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

TNFRSF18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	56,394,559 - 56,397,502 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	56,394,659 - 56,397,741 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	56,471,888 - 56,474,440 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	56,597,800 - 56,600,352 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	56,597,546 - 56,600,352 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	56,588,543 - 56,591,095 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	56,480,829 - 56,483,381 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	56,870,818 - 56,873,370 (-)	NCBI		UU_Cfam_GSD_1.0

Tnfrsf18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	27,555,513 - 27,560,643 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936737	1,905,307 - 1,910,356 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFRSF18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	63,516,045 - 63,518,405 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	63,516,037 - 63,519,323 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	58,018,980 - 58,021,594 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFRSF18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	130,237,950 - 130,243,303 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	130,225,847 - 130,242,251 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	34,806,938 - 34,812,229 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnfrsf18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	8,378,131 - 8,379,974 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	8,376,204 - 8,380,266 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tnfrsf18
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	91
Count of miRNA genes:	76
Interacting mature miRNAs:	82
Transcripts:	ENSRNOT00000038747
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1549904	Neuinf1	Neuroinflammation QTL 1	3	0	nervous system integrity trait (VT:0010566)	blood T lymphocyte count (CMO:0000110)	5	154828214	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat

Markers in Region

U82534

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	166,622,120 - 166,622,262 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,462,996 - 173,463,137	NCBI	Rnor6.0
Rnor_5.0	5	176,937,016 - 176,937,157	UniSTS	Rnor5.0
RGSC_v3.4	5	172,871,563 - 172,871,704	UniSTS	RGSC3.4
Celera	5	164,822,978 - 164,823,119	UniSTS
Cytogenetic Map	5	q36	UniSTS

UniSTS:479307

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	166,621,473 - 166,621,795 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	173,462,349 - 173,462,670	NCBI	Rnor6.0
Rnor_5.0	5	176,936,369 - 176,936,690	UniSTS	Rnor5.0
RGSC_v3.4	5	172,870,916 - 172,871,237	UniSTS	RGSC3.4
Celera	5	164,822,331 - 164,822,652	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			18		36							3
Low	21	27	29	7	33	7	3	11		33	53	48	3
Below cutoff		108	165	128		128	18	31	50	76	61		18

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764374	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC126156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM088311	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000038747 ⟹ ENSRNOP00000035610

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,618,969 - 166,622,353 (+)	Ensembl
Rnor_6.0 Ensembl	5	173,460,354 - 173,463,140 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115857 ⟹ ENSRNOP00000094046

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	166,619,754 - 166,621,983 (+)	Ensembl

RefSeq Acc Id:

NM_001024349 ⟹ NP_001019520

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,901,980 - 171,904,578 (+)	NCBI
mRatBN7.2	5	166,619,755 - 166,622,353 (+)	NCBI
Rnor_6.0	5	173,460,630 - 173,463,228 (+)	NCBI
Rnor_5.0	5	176,933,400 - 176,938,350 (+)	NCBI
RGSC_v3.4	5	172,869,196 - 172,871,795 (+)	RGD
Celera	5	164,820,612 - 164,823,210 (+)	NCBI

Sequence:

show sequence

ATGTTGGAGCGGGAACTCCTGAAATCAGCCAACAGAAGACTCGGGAGAAGCACTATGGGAGCAT
GGGCCATGCTGTATGGAGTCTCGCTGATTTGTGTGCTGGACCTAGGTCAGCAGAGCATTGCTGA
GGAGCCTAGCTGCGGTCCTGGCAGGGTCCGGAATGGAACTGGCACGAACACACGCTGCTGCAGT
CTGTGTGGTCCAGACAAGGAGGACTGTCCAAAAGGAAGGTGCATATGTGTCAAGCCTGAGTACC
ACTGTGAAGACCCTCAGTGCAAGACCTGCAAACACTACCCCTGCCAACCAGGCCAGAGGGTGGA
GTCTCAAGGGAATATTAAGTTTGGCTTCCAGTGCGTTGACTGTGCCATGGGTACCTTCTCTGCA
GGTCGTGAGGGTCACTGCAGACTTTGGACCAACTGTTCTCAGTTTGGATTTCTCACCGTGTTCC
CCGGGAACAAGACCCACAATGCTGTGTGCATCCCGGAGCCACTGCCCACTGAGCAATATGGCCA
TTTGACTGTCATCTTCCTGGTCATGGCTGCATGCATTCTCTTCTTAACCACAGTCCAGCTCGGC
CTGCACATATGGCAGCTGAGGAGGCAACACACGTGTCCCCGAGATACCCAGCCGCTCCTGGAGG
TGCAGTTACCACCAGCTGAGGATGCTTGCAGCTTCCAGTTTCCTGAGGAGGAACGTGGGGAGCA
GATGGAAGAAAAGTGTCGTCTGGGGGACCGGTGGCCATGAGGCCTGTTCTTCCTCTGTGCCCCA
AGTCAGACTCTACAAGACTTGCCCAGAAATACCCTTGGTGAGAGCAGGGGCTATGCTCTGCGTC
CTTCCCTGGGCCTGGCCCCACTCCCCTGGACAATGGCGGAAGTGGGTGTGAGACGGTAGTGGTG
AGTTACAACTGAGCCCTGTGGCTGCCTTTCTCATTTGCCAGCTCTGTGGAGCAGGGTCTTTGGG
CCCTCCAAGAACACCAAGTTTAGCACAAGATCTTATACAAGTGGTTTTCAATAAATACTTGTCT
AGTAA

hide sequence

RefSeq Acc Id:

XM_039110656 ⟹ XP_038966584

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	171,901,734 - 171,904,034 (+)	NCBI
mRatBN7.2	5	166,618,461 - 166,621,809 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019520	(Get FASTA)	NCBI Sequence Viewer
	XP_038966584	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88265	(Get FASTA)	NCBI Sequence Viewer
	EDL81355	(Get FASTA)	NCBI Sequence Viewer
	EDL81356	(Get FASTA)	NCBI Sequence Viewer
	EDL81357	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035610.4
	ENSRNOP00000094046.1

RefSeq Acc Id:	NP_001019520 ⟸ NM_001024349
- Peptide Label:	precursor
- UniProtKB:	A6IUV5 (UniProtKB/TrEMBL), F7FFS7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGAWAMLYGVSLICVLDLGQQSIAEEPSCGPGRVRNGTGTNTRCCSLCGPDKEDCPKGRCICVK PEYHCEDPQCKTCKHYPCQPGQRVESQGNIKFGFQCVDCAMGTFSAGREGHCRLWTNCSQFGFL TVFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACILFLTTVQLGLHIWQLRRQHTCPRDTQP LLEVQLPPAEDACSFQFPEEERGEQMEEKCRLGDRWP hide sequence

Ensembl Acc Id:

ENSRNOP00000035610 ⟸ ENSRNOT00000038747

RefSeq Acc Id:	XP_038966584 ⟸ XM_039110656
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000094046 ⟸ ENSRNOT00000115857

Protein Domains

TNFR-Cys

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7FFS7-F1-model_v2	AlphaFold	F7FFS7	1-274	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565872	AgrOrtholog
BioCyc Gene	G2FUF-38877	BioCyc
Ensembl Genes	ENSRNOG00000022012	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000038747.5	UniProtKB/TrEMBL
	ENSRNOT00000115857.1	UniProtKB/TrEMBL
Gene3D-CATH	Tumor Necrosis Factor Receptor, subunit A, domain 2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7377562	IMAGE-MGC_LOAD
InterPro	TNFR/NGFR_Cys_rich_reg	UniProtKB/TrEMBL
	TNFR_18	UniProtKB/TrEMBL
	TNFRSF18	UniProtKB/TrEMBL
	TNFRSF18_N	UniProtKB/TrEMBL
MGC_CLONE	MGC:109095	IMAGE-MGC_LOAD
NCBI Gene	500598	ENTREZGENE
PANTHER	TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER 18	UniProtKB/TrEMBL
	TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER 18	UniProtKB/TrEMBL
PhenoGen	Tnfrsf18	PhenoGen
PRINTS	TNFACTORR18	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000022012	RatGTEx
SMART	TNFR	UniProtKB/TrEMBL
UniProt	A0A8I6AIP6_RAT	UniProtKB/TrEMBL
	A6IUV5	ENTREZGENE, UniProtKB/TrEMBL
	F7FFS7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-05	Tnfrsf18	TNF receptor superfamily member 18	Tnfrsf18	tumor necrosis factor receptor superfamily, member 18	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-21	Tnfrsf18	tumor necrosis factor receptor superfamily, member 18	LOC500598	similar to tumor necrosis factor receptor superfamily, member 18	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC500598	similar to tumor necrosis factor receptor superfamily, member 18			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)