Sptssa (serine palmitoyltransferase, small subunit A)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sptssa (serine palmitoyltransferase, small subunit A) Rattus norvegicus

Analyze

Symbol:

Sptssa

Name:

serine palmitoyltransferase, small subunit A

RGD ID:

1565821

Description:

Predicted to contribute to serine C-palmitoyltransferase activity. Predicted to be involved in ceramide biosynthetic process; protein localization; and sphingosine biosynthetic process. Predicted to be located in endoplasmic reticulum. Predicted to be part of serine C-palmitoyltransferase complex. Orthologous to human SPTSSA (serine palmitoyltransferase small subunit A); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC500651; MGC112883; serine palmitoyltransferase small subunit A; small subunit of serine palmitoyltransferase A; Ssspta

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	72,144,714 - 72,156,130 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	72,144,714 - 72,156,214 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	72,565,588 - 72,577,037 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	72,872,259 - 72,883,710 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	72,302,687 - 72,314,091 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	75,540,132 - 75,551,545 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	75,540,174 - 75,551,625 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	85,080,132 - 85,091,844 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	74,962,387 - 74,973,800 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	70,991,533 - 71,002,947 (-)	NCBI		Celera
Cytogenetic Map	6	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain-Lung-Thyroid Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-methylcholanthrene (ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dioxygen (ISO)

doxorubicin (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

gentamycin (EXP)

methapyrilene (EXP)

methyl methanesulfonate (ISO)

miconazole (ISO)

nefazodone (EXP)

oxaliplatin (EXP)

paracetamol (EXP)

progesterone (ISO)

resorcinol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

topotecan (EXP)

tributylstannane (EXP)

trichostatin A (ISO)

trovafloxacin (EXP)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ceramide biosynthetic process (IBA,ISO)

protein localization (ISO,ISS)

sphingosine biosynthetic process (ISO)

Cellular Component

endoplasmic reticulum (ISO,ISS)

endoplasmic reticulum membrane (IEA)

serine C-palmitoyltransferase complex (IBA,ISO,ISS)

Molecular Function

protein binding (ISO)

serine C-palmitoyltransferase activity (IBA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:19416851	PMID:23510452	PMID:25691431

Genomics

Comparative Map Data

Sptssa
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	72,144,714 - 72,156,130 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	72,144,714 - 72,156,214 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	72,565,588 - 72,577,037 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	72,872,259 - 72,883,710 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	72,302,687 - 72,314,091 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	75,540,132 - 75,551,545 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	75,540,174 - 75,551,625 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	85,080,132 - 85,091,844 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	74,962,387 - 74,973,800 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	70,991,533 - 71,002,947 (-)	NCBI		Celera
Cytogenetic Map	6	q23	NCBI

SPTSSA
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	34,432,788 - 34,462,240 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	14	34,432,788 - 34,462,240 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	34,901,994 - 34,931,446 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	33,971,895 - 34,001,219 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	33,971,904 - 34,001,313	NCBI
Celera	14	14,767,183 - 14,796,506 (-)	NCBI		Celera
Cytogenetic Map	14	q13.1	NCBI
HuRef	14	15,020,179 - 15,049,457 (-)	NCBI		HuRef
CHM1_1	14	34,900,608 - 34,930,130 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	28,631,319 - 28,661,012 (-)	NCBI		T2T-CHM13v2.0

Sptssa
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	54,692,159 - 54,703,357 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	54,692,177 - 54,703,358 (-)	Ensembl		GRCm39 Ensembl
GRCm38	12	54,645,374 - 54,656,572 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	54,645,392 - 54,656,573 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	55,746,361 - 55,757,559 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	55,567,018 - 55,578,124 (-)	NCBI		MGSCv36	mm8
Celera	12	55,961,951 - 55,973,156 (-)	NCBI		Celera
Cytogenetic Map	12	C1	NCBI

Sptssa
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955409	26,460,208 - 26,460,854 (+)	NCBI	ChiLan1.0	ChiLan1.0

SPTSSA
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Mhudiblu_PPA_v0	14	15,190,833 - 15,219,882 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

LOC102151865
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	13,265,424 - 13,339,212 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	13,077,984 - 13,151,811 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	13,284,591 - 13,447,278 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	8	12,965,994 - 13,127,949 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	13,049,110 - 13,211,027 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	13,427,103 - 13,501,270 (-)	NCBI		UU_Cfam_GSD_1.0

Sptssa
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	45,211,157 - 45,233,059 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936494	8,716,829 - 8,739,066 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936494	8,717,821 - 8,738,923 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPTSSA
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	65,302,858 - 65,326,728 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	65,302,887 - 65,325,877 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	70,090,613 - 70,113,604 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPTSSA
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	11,264,578 - 11,298,816 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	11,266,343 - 11,298,668 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	201,739 - 236,078 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sptssa
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624838	2,206,917 - 2,231,518 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624838	2,207,003 - 2,231,838 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sptssa
86 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	78
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000005825
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	32074428	72227641	Rat
6893340	Cm77	Cardiac mass QTL 77	0.26	0.57	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	33309549	81132889	Rat
1300143	Rf14	Renal function QTL 14	2.92		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	34434137	77102317	Rat
634307	Bp141	Blood pressure QTL 141	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	35230417	80230417	Rat
9590290	Uminl2	Urine mineral level QTL 2	3.96	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	6	38783989	83783989	Rat
9590306	Scort18	Serum corticosterone level QTL 18	2.88	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
9590140	Scort4	Serum corticosterone level QTL 4	14.49	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	38783989	83783989	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
4889848	Pur25	Proteinuria QTL 25	14	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	56728562	90198260	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	10	74	35	38	11	8
Low								1			3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001047743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228761	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000005825 ⟹ ENSRNOP00000005825

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	72,144,714 - 72,156,214 (-)	Ensembl
Rnor_6.0 Ensembl	6	75,540,174 - 75,551,625 (-)	Ensembl

RefSeq Acc Id:

NM_001047743 ⟹ NP_001041208

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	72,144,714 - 72,156,130 (-)	NCBI
Rnor_6.0	6	75,540,132 - 75,551,545 (-)	NCBI
Rnor_5.0	6	85,080,132 - 85,091,844 (-)	NCBI
RGSC_v3.4	6	74,962,387 - 74,973,800 (-)	RGD
Celera	6	70,991,533 - 71,002,947 (-)	RGD

Sequence:

show sequence

CGCGGGAGGCGCATGGCGGGCATGGCGTTGGCGCGAGCATGGAAGCAGATGTCCTGGTTCTACT
ACCAGTACTTGCTGGTCACTGCGCTCTACATGCTGGAGCCCTGGGAGCGAACCGTGTTCAATTC
GATGCTGGTTTCTGTGGTGGGGATGGCACTGTACACCGGCTACGTCTTCATGCCCCAGCACATC
ATGGCAATACTGCATTACTTTGAAATTGTACAGTGACGGAGATGTGACCAGGATCCAGAGGCTC
CTGGGGAAGATCCACCTTGTGAAGTTGGGACGAGACCTCGTCACATGTGAGATGCTCTACGGAT
GTCAACATAACCAACCTTATAAATACAGAGACTAAACTTCATGAGTAGAACAGGAGAAATCATC
CTGACTCATGTGTTGTGTTCCTTCCTTTTGATTTTAAAAGAGGCTCTTACATAGTAGCTTTTAT
CTATTTTAACATTGTAGTCATTTGTACTTTGATATCAGTATTTTCTTAACCTTTGTGACTGTTT
CAATATTACCCAGTGAAAGCTTTTCTTAATGTAACTTTGAGTACATCTTAACTGCCTTCTATTT
TTAAAACCTAAGGTCGTTAGTTGGGCTTTACTGTTCTTGCTATCGTATGGCATACACATCTGCC
TGGATATATTTCTACTCGACCAAAGTTTTGTAAGAAACAATACAGAATTTGGGGATGGGAGGGA
GGATATTTTGAGAAGTACTTACAAAAGATTTATCTGTAAGCTTGACCTCAGGGGTACGGTTTTA
GCTCCCTAGACTCTTTAACAGCTTTTGCTCTAAAACTATTAAAGTGTTTCTTAGTGATGAAAAA
GTAAAGATCTTGCTAACATTAATACAAGGAGCATTTCACCTTTTAGATATTAAATTCTTATGTG
GACTTATTTCCAACTAACTTTTTCGATTCCTGTGAGGGCGGGTGACTGGTGGCCTTGTGCGATG
CTGAGATGTACCATGGAGCTTTTCATAGAAGGCAGATCGGTTTCCTCTGAGGAGATACTGACAG
TGGATACGCTTAAGAGTTAACTTGATGATTGTCACAGGTGCTGTGAAATGCATTTGCACATTGT
GATAAGATATCATGAGATGAATTGTTCAGAACCATAGCCAAAAGAAATGTAAACTTGCTTAAAA
ATCCTTTCACTCTTTGTATTTTTTTAAAATGGTTTTTATTCCTTAGATGTAAAATGACTACTTA
ATTTTTTTTGATGTAAACTCATTAAATTCAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001041208	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98829	(Get FASTA)	NCBI Sequence Viewer
	EDM03407	(Get FASTA)	NCBI Sequence Viewer
	Q4G019	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001041208 ⟸ NM_001047743
- UniProtKB:	Q4G019 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSVVGMALYTGYVFMPQHIMAIL HYFEIVQ hide sequence

RefSeq Acc Id:

ENSRNOP00000005825 ⟸ ENSRNOT00000005825

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4G019-F1-model_v2	AlphaFold	Q4G019	1-71	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694597

Promoter ID:

EPDNEW_R5121

Type:

initiation region

Name:

Sptssa_1

Description:

serine palmitoyltransferase, small subunit A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	75,551,560 - 75,551,620	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565821	AgrOrtholog
BioCyc Gene	G2FUF-37538	BioCyc
Ensembl Genes	ENSRNOG00000004292	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000005825	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000005825	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	Ser_palmitoyltrfase_ssu-like	UniProtKB/Swiss-Prot
KEGG Report	rno:500651	UniProtKB/Swiss-Prot
NCBI Gene	500651	ENTREZGENE
Pfam	SPT_ssu-like	UniProtKB/Swiss-Prot
PhenoGen	Sptssa	PhenoGen
UniProt	Q4G019	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-16	Sptssa	serine palmitoyltransferase, small subunit A	MGC112883	LOC500651	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	MGC112883	LOC500651			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar