Pax5 (paired box 5) - Rat Genome Database

Name: Pax5
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pax5 (paired box 5) Rattus norvegicus

Analyze

Symbol:

Pax5

Name:

paired box 5

RGD ID:

1565236

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in anatomical structure development and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including embryonic cranial skeleton morphogenesis; regulation of transcription by RNA polymerase II; and telencephalon development. Predicted to be located in nucleoplasm. Human ortholog(s) of this gene implicated in acute lymphoblastic leukemia. Orthologous to human PAX5 (paired box 5); INTERACTS WITH amphetamine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC500453; LOC500453; paired box protein Pax-5; RGD1565236; similar to transcription factor; uncharacterized protein LOC500453

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PAX5 (paired box 5)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB
Mus musculus (house mouse):	Pax5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pax5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PAX5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PAX5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pax5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PAX5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PAX5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pax5 (paired box 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PAX5 (paired box 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pax5 (paired box 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pax5 (paired box 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-38	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sv	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pax5	Alliance	DIOPT (OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,765,036 - 58,944,326 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	60,744,271 - 60,923,281 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	62,563,059 - 62,742,070 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	62,532,699 - 62,711,294 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	60,007,587 - 60,191,973 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	60,007,587 - 60,191,941 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	64,530,218 - 64,707,784 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	61,016,708 - 61,131,315 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	57,341,131 - 57,518,116 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

acute lymphoblastic leukemia (ISO)

B-lymphoblastic leukemia/lymphoma (ISO)

distal arthrogryposis type 1A (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis-6 (ISO)

galactosemia (ISO)

genetic disease (ISO)

Neurodevelopmental Disorders (ISO)

primary ciliary dyskinesia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

capecitabine (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

dimethylarsinic acid (ISO)

dorsomorphin (ISO)

entinostat (ISO)

folic acid (ISO)

fulvestrant (ISO)

irinotecan (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

methoxychlor (EXP)

methylarsonic acid (ISO)

N,N-diethyl-m-toluamide (EXP)

ozone (ISO)

paraquat (ISO)

permethrin (EXP)

progesterone (ISO)

raloxifene (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

testosterone (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult behavior (ISO)

anatomical structure development (IBA)

cerebral cortex development (ISO)

embryonic cranial skeleton morphogenesis (ISO)

lateral ventricle development (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of DNA-templated transcription (ISO)

regulation of transcription by RNA polymerase II (IBA)

skeletal muscle cell differentiation (ISO)

Cellular Component

nucleoplasm (IEA,ISO)

nucleus (ISO)

Molecular Function

DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12244173	PMID:14594818	PMID:15094381	PMID:15258579	PMID:16618805	PMID:22147266	PMID:23349049

Genomics

Comparative Map Data

Pax5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,765,036 - 58,944,326 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	60,744,271 - 60,923,281 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	62,563,059 - 62,742,070 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	62,532,699 - 62,711,294 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	60,007,587 - 60,191,973 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	60,007,587 - 60,191,941 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	64,530,218 - 64,707,784 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	61,016,708 - 61,131,315 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	57,341,131 - 57,518,116 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

PAX5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	36,833,269 - 37,034,268 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	36,833,269 - 37,034,268 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	36,833,266 - 37,034,265 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	36,828,531 - 37,024,476 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	36,828,530 - 37,024,476	NCBI
Celera	9	36,771,847 - 36,967,843 (-)	NCBI		Celera
Cytogenetic Map	9	p13.2	NCBI
HuRef	9	36,784,641 - 36,985,496 (-)	NCBI		HuRef
CHM1_1	9	36,834,374 - 37,035,683 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	36,856,835 - 37,057,984 (-)	NCBI		T2T-CHM13v2.0

Pax5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	44,524,748 - 44,710,694 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	44,524,757 - 44,710,487 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	44,524,748 - 44,710,694 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	44,524,757 - 44,710,487 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	44,544,378 - 44,723,312 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	44,552,606 - 44,731,540 (-)	NCBI		MGSCv36	mm8
Celera	4	44,550,836 - 44,729,998 (-)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	23.55	NCBI

Pax5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	29,395,389 - 29,570,952 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	29,395,631 - 29,577,272 (+)	NCBI	ChiLan1.0	ChiLan1.0

PAX5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	87,573,981 - 87,637,726 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	36,677,369 - 36,876,678 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	37,474,267 - 37,673,684 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	37,474,267 - 37,673,684 (-)	Ensembl	panpan1.1		panPan2

PAX5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	53,194,905 - 53,390,204 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	53,201,344 - 53,390,974 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	51,785,891 - 51,981,004 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	54,304,295 - 54,499,334 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	54,303,708 - 54,499,571 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	52,803,918 - 52,998,984 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	52,832,452 - 53,027,560 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	53,528,788 - 53,723,946 (-)	NCBI		UU_Cfam_GSD_1.0

Pax5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	168,146,873 - 168,333,200 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	4,700,841 - 4,887,106 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936524	4,700,815 - 4,887,035 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PAX5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	237,575,061 - 237,785,413 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	237,574,938 - 237,785,454 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	265,431,252 - 265,635,349 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PAX5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	43,547,399 - 43,748,202 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	43,548,914 - 43,740,962 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	40,624,837 - 40,822,776 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pax5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624930	491,892 - 667,530 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624930	491,220 - 660,476 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pax5
1032 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	56
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000033373
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat

Markers in Region

D5Rat9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	58,829,236 - 58,829,371 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	60,072,951 - 60,073,085	NCBI	Rnor6.0
Rnor_5.0	5	64,593,776 - 64,593,910	UniSTS	Rnor5.0
RGSC_v3.4	5	61,080,077 - 61,080,454	RGD	RGSC3.4
RGSC_v3.4	5	61,080,143 - 61,080,277	UniSTS	RGSC3.4
RGSC_v3.1	5	61,080,322 - 61,080,456	RGD
Celera	5	57,404,042 - 57,404,176	UniSTS
RH 3.4 Map	5	378.7	UniSTS
RH 3.4 Map	5	378.7	RGD
SHRSP x BN Map	5	36.1899	UniSTS
SHRSP x BN Map	5	36.1899	RGD
Cytogenetic Map	5	q22	UniSTS

D9Got117

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	58,899,623 - 58,899,719 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	60,143,328 - 60,143,423	NCBI	Rnor6.0
Rnor_5.0	5	64,664,153 - 64,664,248	UniSTS	Rnor5.0
RGSC_v3.4	5	61,152,632 - 61,152,728	RGD	RGSC3.4
RGSC_v3.4	5	61,152,633 - 61,152,728	UniSTS	RGSC3.4
RGSC_v3.1	5	61,152,812 - 61,152,907	RGD
Celera	5	57,473,989 - 57,474,084	UniSTS
RH 3.4 Map	5	394.7	RGD
RH 3.4 Map	5	394.7	UniSTS
Cytogenetic Map	5	q22	UniSTS

RH132289

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	58,926,076 - 58,926,269 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	60,171,935 - 60,172,127	NCBI	Rnor6.0
Rnor_5.0	5	64,690,754 - 64,690,946	UniSTS	Rnor5.0
Celera	5	57,500,439 - 57,500,631	UniSTS
RH 3.4 Map	5	375.81	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2				11				10			1
Low			15	7	8	7			25	1	1	10
Below cutoff		14	37	29		29	4	5	23	13	27		4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000033373 ⟹ ENSRNOP00000030607

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,766,036 - 58,944,326 (-)	Ensembl
Rnor_6.0 Ensembl	5	60,007,587 - 60,191,941 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101578 ⟹ ENSRNOP00000085101

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,765,036 - 58,944,326 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103697 ⟹ ENSRNOP00000091171

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,765,036 - 58,944,326 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110928 ⟹ ENSRNOP00000090539

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,766,036 - 58,944,326 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112306 ⟹ ENSRNOP00000087974

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,765,036 - 58,944,326 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117108 ⟹ ENSRNOP00000078511

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,765,036 - 58,944,326 (-)	Ensembl

RefSeq Acc Id:

NM_001109261 ⟹ NP_001102731

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,766,036 - 58,944,326 (-)	NCBI
Rnor_6.0	5	60,007,587 - 60,191,973 (-)	NCBI
Rnor_5.0	5	64,530,218 - 64,707,784 (-)	NCBI
RGSC_v3.4	5	61,016,708 - 61,131,315 (-)	RGD
Celera	5	57,341,131 - 57,518,116 (-)	RGD

Sequence:

show sequence

TATCCATTTCATCAAATCCTGAAATAATCAAAATGGATTTAGAGAAAAATTACCCAACTCCTCG
GACCATCAGGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCA
CTCCCAGATGTAGTCCGCCAAAGGATAGTGGAACTTGCCCATCAAGGTGTCAGGCCCTGCGACA
TCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGAC
AGGAAGCATCAAGCCGGGGGTGATCGGAGGATCCAAACCAAAGGTTGCCACTCCCAAAGTGGTG
GAAAAAATCGCTGAGTACAAACGCCAAAATCCTACCATGTTTGCCTGGGAGATCAGGGACCGGC
TGCTGGCAGAGCGAGTGTGTGACAATGACACAGTGCCCAGTGTCAGCTCCATCAACAGGATCAT
CCGGACAAAAGTACAGCAGCCCCCCAATCAGCCGGTCCCAGCTTCCAGTCACAGCATAGTGTCT
ACAGGCTCCGTGACGCAGGTGTCGTCGGTGAGCACCGACTCTGCAGGCTCCTCGTACTCCATCA
GCGGCATCCTGGGCATCACGTCCCCCAGTGCCGACACCAACAAGCGCAAGAGGGATGAAGGTAT
TCAGGAGTCTCCCGTGCCGAATGGCCACTCACTTCCAGGCCGAGACTTCCTCCGAAAGCAGATG
CGGGGAGATCTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTCGAGAGACAGCACT
ACTCAGACATCTTCACCACCACGGAGCCCATCAAGCCAGAGCAGACCACAGAGTATTCAGCCAT
GGCTTCACTGGCTGGAAGCCTGGATGATATGAAAGCCAACTTGACAAGCCCCACCCCCGCTGAC
ATCGGGAGCAGCGTTCCAGGCCCGCAGTCCTACCCCATTGTCACAGGCCGAGACTTGGCAAGCA
CGACCCTTCCGGGGTACCCTCCGCACGTGCCCCCCGCTGGACAGGGCAGCTACTCTGCACCGAC
GCTGACAGGGATGGTGCCTGGGAGCGAATTTTCTGGGAGTCCCTACAGCCACCCTCAATATTCC
TCCTACAATGATTCATGGAGGTTCCCCAACCCAGGGCTGCTCGGCTCCCCATACTATTACAGCG
CCGCAGCCCGAGGAGCCGCCCCACCGGCCGCAGCCACCGCCTACGACCGCCACTGA

hide sequence

RefSeq Acc Id:

XM_039110563 ⟹ XP_038966491

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI

RefSeq Acc Id:

XM_039110564 ⟹ XP_038966492

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,938,616 (-)	NCBI

RefSeq Acc Id:

XM_039110566 ⟹ XP_038966494

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,938,616 (-)	NCBI

RefSeq Acc Id:

XM_039110567 ⟹ XP_038966495

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI

RefSeq Acc Id:

XM_039110568 ⟹ XP_038966496

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI

RefSeq Acc Id:

XM_039110569 ⟹ XP_038966497

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI

RefSeq Acc Id:

XM_039110570 ⟹ XP_038966498

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	58,763,334 - 58,945,719 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102731	(Get FASTA)	NCBI Sequence Viewer
	XP_038966491	(Get FASTA)	NCBI Sequence Viewer
	XP_038966492	(Get FASTA)	NCBI Sequence Viewer
	XP_038966494	(Get FASTA)	NCBI Sequence Viewer
	XP_038966495	(Get FASTA)	NCBI Sequence Viewer
	XP_038966496	(Get FASTA)	NCBI Sequence Viewer
	XP_038966497	(Get FASTA)	NCBI Sequence Viewer
	XP_038966498	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98794	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001102731 ⟸ NM_001109261

- UniProtKB:

A0A8I5ZL27 (UniProtKB/TrEMBL), A6IJ74 (UniProtKB/TrEMBL), F1M4W2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDLEKNYPTPRTIRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGC
VSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDT
VPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSA
DTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPI
KPEQTTEYSAMASLAGSLDDMKANLTSPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVP
PAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAA
ATAYDRH

hide sequence

RefSeq Acc Id:

ENSRNOP00000030607 ⟸ ENSRNOT00000033373

RefSeq Acc Id:	XP_038966498 ⟸ XM_039110570
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038966496 ⟸ XM_039110568
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I6AHR4 (UniProtKB/TrEMBL), F1M4W2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038966495 ⟸ XM_039110567
- Peptide Label:	isoform X4
- UniProtKB:	F1M4W2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038966491 ⟸ XM_039110563
- Peptide Label:	isoform X1
- UniProtKB:	F1M4W2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038966497 ⟸ XM_039110569
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038966494 ⟸ XM_039110566
- Peptide Label:	isoform X3
- UniProtKB:	F1M4W2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038966492 ⟸ XM_039110564
- Peptide Label:	isoform X2
- UniProtKB:	F1M4W2 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000087974 ⟸ ENSRNOT00000112306

RefSeq Acc Id:

ENSRNOP00000078511 ⟸ ENSRNOT00000117108

RefSeq Acc Id:

ENSRNOP00000091171 ⟸ ENSRNOT00000103697

RefSeq Acc Id:

ENSRNOP00000090539 ⟸ ENSRNOT00000110928

RefSeq Acc Id:

ENSRNOP00000085101 ⟸ ENSRNOT00000101578

Protein Domains

Paired

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M4W2-F1-model_v2	AlphaFold	F1M4W2	1-391	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565236	AgrOrtholog
BioCyc Gene	G2FUF-41467	BioCyc
Ensembl Genes	ENSRNOG00000024729	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000030607.7	UniProtKB/TrEMBL
	ENSRNOP00000078511	ENTREZGENE
	ENSRNOP00000078511.1	UniProtKB/TrEMBL
	ENSRNOP00000085101.1	UniProtKB/TrEMBL
	ENSRNOP00000087974	ENTREZGENE
	ENSRNOP00000087974.1	UniProtKB/TrEMBL
	ENSRNOP00000090539.1	UniProtKB/TrEMBL
	ENSRNOP00000091171.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000033373.7	UniProtKB/TrEMBL
	ENSRNOT00000101578.1	UniProtKB/TrEMBL
	ENSRNOT00000103697.1	UniProtKB/TrEMBL
	ENSRNOT00000110928.1	UniProtKB/TrEMBL
	ENSRNOT00000112306	ENTREZGENE
	ENSRNOT00000112306.1	UniProtKB/TrEMBL
	ENSRNOT00000117108	ENTREZGENE
	ENSRNOT00000117108.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
InterPro	Homeobox-like_sf	UniProtKB/TrEMBL
	PAIRED_DNA_bd_dom	UniProtKB/TrEMBL
	Paired_dom	UniProtKB/TrEMBL
	Pax2_C	UniProtKB/TrEMBL
	PAX_fam	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:500453	UniProtKB/TrEMBL
NCBI Gene	500453	ENTREZGENE
PANTHER	PAIRED BOX PROTEIN PAX-5	UniProtKB/TrEMBL
	PTHR45636	UniProtKB/TrEMBL
Pfam	PAX	UniProtKB/TrEMBL
	Pax2_C	UniProtKB/TrEMBL
PhenoGen	Pax5	PhenoGen
PRINTS	PAIREDBOX	UniProtKB/TrEMBL
PROSITE	PAIRED_1	UniProtKB/TrEMBL
	PAIRED_2	UniProtKB/TrEMBL
SMART	PAX	UniProtKB/TrEMBL
Superfamily-SCOP	SSF46689	UniProtKB/TrEMBL
UniProt	A0A8I5ZL27	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZYI3_RAT	UniProtKB/TrEMBL
	A0A8I6AB34_RAT	UniProtKB/TrEMBL
	A0A8I6ACQ3_RAT	UniProtKB/TrEMBL
	A0A8I6AHR4	ENTREZGENE, UniProtKB/TrEMBL
	A6IJ74	ENTREZGENE, UniProtKB/TrEMBL
	F1M4W2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-12	Pax5	paired box 5	RGD1565236	similar to transcription factor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1565236	similar to transcription factor	RGD1565236_predicted	similar to transcription factor (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1565236_predicted	similar to transcription factor (predicted)	LOC500453	similar to transcription factor	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500453	similar to transcription factor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM