Dct (dopachrome tautomerase) - Rat Genome Database

Name: Dct
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Dct (dopachrome tautomerase) Rattus norvegicus

Analyze

Symbol:

Dct

Name:

dopachrome tautomerase

RGD ID:

1564975

Description:

Predicted to enable dopachrome isomerase activity. Predicted to be involved in melanin biosynthetic process from tyrosine and response to blue light. Predicted to act upstream of or within several processes, including melanin biosynthetic process; positive regulation of neuroblast proliferation; and ventricular zone neuroblast division. Predicted to be located in cytosol; melanosome; and plasma membrane. Human ortholog(s) of this gene implicated in oculocutaneous albinism. Orthologous to human DCT (dopachrome tautomerase); PARTICIPATES IN alkaptonuria pathway; disulfiram pharmacodynamics pathway; dopamine beta-hydroxylase deficiency pathway; INTERACTS WITH bisphenol A; Cuprizon; diuron.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2); L-dopachrome tautomerase; LOC290484; RGD1564975; similar to Dopachrome tautomerase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DCT (dopachrome tautomerase)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Dct (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dct (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DCT (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DCT (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dct (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DCT (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DCT (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dct (dopachrome tautomerase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DCT (dopachrome tautomerase)	Alliance	DIOPT (HGNC)

Is Marker For:

Strains: F344-Tg(Dct-lacZ)9Kyo

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	15	95,062,006 - 95,100,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	95,062,003 - 95,100,836 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	15	103,208,174 - 103,245,033 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	103,208,258 - 103,244,494 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	106,647,067 - 106,681,458 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	102,798,699 - 102,832,240 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	93,915,976 - 93,952,737 (-)	NCBI		Celera
Cytogenetic Map	15	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Albinism (ISO)

Anal Atresia, Hypospadias, and Penoscrotal Inversion (ISO)

genetic disease (ISO)

holoprosencephaly 5 (ISO)

Oculocutaneous Albinism Type VIII (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-artemisinic acid (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

5,6-dihydroxyindole-2-carboxylic acid (ISO)

5-fluorouracil (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amentoflavone (ISO)

arachidonic acid (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

carboplatin (ISO)

CGP 52608 (ISO)

ciguatoxin CTX1B (ISO)

clofibrate (ISO)

colforsin daropate hydrochloride (ISO)

Cuprizon (EXP)

dichloroacetic acid (ISO)

diuron (EXP)

doxorubicin (ISO)

emodin (ISO)

etoposide (ISO)

eumelanin (ISO)

formaldehyde (ISO)

fulvestrant (ISO)

genistein (ISO)

glycidol (EXP)

isoprenaline (ISO)

kojic acid (ISO)

lipopolysaccharide (ISO)

LY294002 (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mitomycin C (ISO)

N-acetyl-beta-D-glucosamine (ISO)

N-acetyl-D-glucosamine (ISO)

N-nitrosodiethylamine (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

nonanedioic acid (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

quercetin (ISO)

resorcinol (ISO)

resveratrol (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 203580 (ISO)

scoparone (ISO)

silicon dioxide (ISO)

Sweroside (ISO)

tamoxifen (ISO)

taurine (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

trichloroethene (ISO)

trichostatin A (ISO)

troglitazone (ISO)

xylitol (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell development (ISO)

developmental pigmentation (ISO)

melanin biosynthetic process (ISO)

melanin biosynthetic process from tyrosine (ISO)

neuroblast proliferation (ISO)

pigmentation (ISO)

positive regulation of neuroblast proliferation (ISO)

response to blue light (ISO)

ventricular zone neuroblast division (ISO)

Cellular Component

cytoplasm (ISO)

cytosol (ISO)

intracellular membrane-bounded organelle (ISO)

melanosome (ISO)

melanosome membrane (IEA)

plasma membrane (IEA,ISO)

Molecular Function

dopachrome isomerase activity (ISO)

oxidoreductase activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

alkaptonuria pathway (ISO)

disulfiram pharmacodynamics pathway (ISO)

dopamine beta-hydroxylase deficiency pathway (ISO)

hawkinsinuria pathway (ISO)

tyrosine metabolic pathway (IEA,ISO)

tyrosinemia type I pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1537334	PMID:2169885	PMID:7665913	PMID:15060160	PMID:16857183	PMID:21610032	PMID:26620560

Genomics

Comparative Map Data

Dct
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	15	95,062,006 - 95,100,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	95,062,003 - 95,100,836 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	15	103,208,174 - 103,245,033 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	103,208,258 - 103,244,494 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	106,647,067 - 106,681,458 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	102,798,699 - 102,832,240 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	93,915,976 - 93,952,737 (-)	NCBI		Celera
Cytogenetic Map	15	q24	NCBI

DCT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	94,436,811 - 94,549,406 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	94,436,811 - 94,479,682 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	95,089,065 - 95,201,660 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	93,889,836 - 93,929,924 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	93,889,839 - 93,929,924	NCBI
Celera	13	75,940,079 - 75,980,144 (-)	NCBI		Celera
Cytogenetic Map	13	q32.1	NCBI
HuRef	13	75,688,784 - 75,728,851 (-)	NCBI		HuRef
CHM1_1	13	95,061,346 - 95,101,397 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	13	93,640,358 - 93,752,911 (-)	NCBI		T2T-CHM13v2.0

Dct
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	118,250,202 - 118,289,658 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	118,250,202 - 118,289,656 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	118,012,790 - 118,052,246 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	118,012,790 - 118,052,244 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	118,412,012 - 118,451,468 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	116,895,153 - 116,934,531 (-)	NCBI		MGSCv36	mm8
Celera	14	116,565,242 - 116,604,520 (-)	NCBI		Celera
Cytogenetic Map	14	E4	NCBI
cM Map	14	61.6	NCBI

Dct
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	15,359,402 - 15,395,535 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	15,359,402 - 15,395,556 (+)	NCBI	ChiLan1.0	ChiLan1.0

DCT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	13	94,613,198 - 94,755,220 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	75,590,366 - 75,730,956 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	94,773,794 - 94,886,791 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	94,773,794 - 94,816,083 (-)	Ensembl	panpan1.1		panPan2

DCT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	45,271,709 - 45,305,272 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	45,271,709 - 45,305,346 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	45,058,426 - 45,092,104 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	45,702,218 - 45,736,012 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	45,702,218 - 45,736,086 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	45,356,018 - 45,389,781 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	45,396,691 - 45,430,530 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	45,406,488 - 45,440,246 (-)	NCBI		UU_Cfam_GSD_1.0

Dct
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	180,841,728 - 180,877,214 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	15,074,633 - 15,110,534 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936472	15,074,947 - 15,110,427 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DCT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	63,584,869 - 63,678,344 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	63,584,865 - 63,647,486 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	69,660,271 - 69,730,937 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DCT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	73,246,161 - 73,315,574 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	73,274,621 - 73,313,905 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	29,653,840 - 29,766,858 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dct
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624879	1,241,910 - 1,279,444 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624879	1,241,593 - 1,346,765 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dct
232 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	96
Count of miRNA genes:	87
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000011571
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	40631268	98288169	Rat
1576315	Schws6	Schwannoma susceptibility QTL 6		0.0069	nervous system integrity trait (VT:0010566)	post-insult time of death (CMO:0002005)	15	53806152	98806152	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	58156477	101769107	Rat
731177	Uae26	Urinary albumin excretion QTL 26	2.4	0.025	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	15	67588667	101769107	Rat
2300326	Plaw1	Placental weight QTL 1	15	0.005	placenta mass (VT:0004257)	placenta wet weight (CMO:0002088)	15	68327165	100062518	Rat
1641889	Colcr6	Colorectal carcinoma resistance QTL 6	2.9	0.0126	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	15	73690518	99794247	Rat
2317055	Aia10	Adjuvant induced arthritis QTL 10	3.41		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	75788062	101769107	Rat
1549844	Bss7	Bone structure and strength QTL 7	6.4		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	15	75788062	101769107	Rat
70155	Gcs1	Gastric cancer susceptibility QTL1	3.8		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	15	76306099	101769107	Rat
1300118	Bp190	Blood pressure QTL 190	2.94		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	15	82262520	98288169	Rat
1300120	Kidm7	Kidney mass QTL 7	3.55		kidney mass (VT:0002707)	left kidney wet weight to body weight ratio (CMO:0001954)	15	82262520	98288169	Rat
1581519	Cm59	Cardiac mass QTL 59	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	15	88853470	95840528	Rat

Markers in Region

DCT

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	95,088,641 - 95,089,156 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	103,232,680 - 103,233,194	NCBI	Rnor6.0
Rnor_5.0	15	106,669,165 - 106,669,679	UniSTS	Rnor5.0
RGSC_v3.4	15	102,820,011 - 102,820,525	UniSTS	RGSC3.4
Celera	15	93,940,556 - 93,941,070	UniSTS
Cytogenetic Map	15	q24	UniSTS

Related Rat Strains

The following Strains have been annotated to Dct

F344-Tg(Dct-lacZ)9Kyo

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									18		1
Low	1	34	1		10				37		33
Below cutoff	2	9	12	1	7	1	3	3	19	22	7	10	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_008770442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008770941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000011571

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	103,208,258 - 103,244,494 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000076707

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	95,062,003 - 95,100,836 (-)	Ensembl
Rnor_6.0 Ensembl	15	103,213,968 - 103,244,494 (-)	Ensembl

RefSeq Acc Id:

XM_008770941 ⟹ XP_008769163

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	15	95,062,006 - 95,100,863 (-)	NCBI
Rnor_6.0	15	103,208,174 - 103,245,033 (-)	NCBI

Sequence:

show sequence

TTAATGATGGCTTCTCCCAGCCCCTCCCCCACGCCCCACCGGGGCCCCGTGGCTTGGCGAGCCG
GAGAGAATAAAGGCAACACGGTGCTTGGCTTTTGAACTGAGTTCAAGGCAATTAAGGTCAAGGG
CTACGGAGAGGAGGAGGCTTAGAAACAGCAGCATAATAAGCCGTACAGCTGGAGCGCTCTGTAA
ATTAACTCAATTAGACAGAGCCCGATTTAACAAGGAAGACTGGCGAGAAGCGCGCCCCTCATTA
AACTTGATGTTAGAGGAGCTTCTGATGAAATTAAATTTGTGTTAGTTGTTTGAGTCACATAAAA
TAGCATGTGCGCGTACACATGTGCACACGTGTAGGCTCTGTGATTTAGGTGGGAATTCTGAGAG
GGTGAGAGGAAAGGGCTAGAACTAAACAGCGAGAGAAGGAAAGGAAAGGAGATTTTGAGTGAGT
GAAGGCCCCAGAACTCAGGAGTGGAAGACAAGGAGGGTAGCCAGACAGAAAACAGGTGGGAAGC
CGAGCCGGGCCTCCCAATTAAGAAGGCATGGGCCTCGTGCGATGGGGGCTTCTGCTGGGTTGCC
TGGGCTGCGGAATTCTGCTCGGAGCTCGGGCTCAGTTTCCCCGCGTCTGCATGACCTTGGATGG
CGTGCTGAACAAAGAATGCTGCCCGCCCCTGGGCCCCGAGGCAAACAACATATGCGGCTTTCTA
GACGGTCGCGGCCAGTGCACCGAGGTGCAGACAGACACCAGGCCCTGGAGCGGCCCTTACGTCC
TTCGAAATCAGGATGACCGTGAGCAGTGGCCAAGAAAATTCTTCAACCGGACTTGCAAATGCAC
AGGAAACTTTGCTGGTTATAATTGTGGAGGCTGCAAGTTTGGCTGGACCGGCCCCGACTGTAAT
CAGAAGAAGCCACCAGTCCTAAGGCAGAATATCCATTCCCTGACTGCCCAGGAGAGGGAGCAGT
TCTTGAGCGCCTTAGACCTAGCGAAGAAGACTATCCACCCAGACTACGTGATCACCACGCAGCA
CTGGCTGGGGCTGCTTGGGCCCAACGGAACCCAGCCCCAGATTGCCAATTGCAGCGTGTATGAC
TTTTTTGTGTGGCTCCATTATTATTCTGTTCGAGACACATTATTAGGTCCAGGACGCCCCTATA
AGGCCATTGATTTCTCTCACCAAGGGCCTGCCTTTGTCACATGGCACAGGTACCATTTGTTGTG
GCTGGAAAGAGAGCTCCAGAGACTCATTGGCAACGAGTCCTTTGCTTTGCCCTATTGGAACTTT
GCCACCGGGAAGAATGAGTGTGACGTGTGCACAGATGAGCTGCTCGGAGCAGCGAGACAAGATG
ACCCGACCCTGATTAGTCAGAACTCAAGGTTCTCTACCTGGGAGATTGTGTGTGACAGTTTGGA
TGACTACAACCGCCGGGTTACCCTGTGTAATGGCACCTACGAAGGTTTGCTGAGAAGAAACAAA
GTAGGCAGAAATAACGAGACATTGCCAACCTTAAAAAATGTGCAAGACTGCCTGTCCCTCCAGG
AGTTTGACAGTCCTCCCTTCTTCCAGAACTCAACCTTCAGCTTCAGGAATGCGCTGGAAGGGTT
TGACAAAGCAGACGGAACATTGGACTCTCAGGTCATGAACCTTCATAACTTGGCTCACTCCTTC
CTGAATGGAACGAATGCCTTGCCACACTCAGCTGCCAACGACCCTGTCTTTGTGGTCCTCCACT
CTTTCACGGACGCCATCTTTGATGAGTGGCTGAGGAAAAACAACCCTTCCACAGATGCCTGGCC
TCAGGAGCTGGCACCCATTGGTCACAATCGGATGTATAACATGGTCCCCTTCTTCCCACCAGTG
ACCAATGAGGAGCTCTTCTTAACCGCAGACCAACTTGGCTACAATTATGCCATTGATCTGTCAG
TGGAAGAAGCTCCAGTTTGGACCACAACCCTCTCAGTGNGCATTGGAATCCTGGGAGTTTTGCT
GGAGTCTTGGCGTTTCTGCTTTCTTCACTACAGAAGGCTTCGCAAAGGCTATGCACCCNTAATG
GAGACAGGCCTAAGCAGCAAGAGATACACAGAGGAGGCCTAACAGGCTCTCTCCGCAGNTGCTT
GACCTAGGTAGTCACTAAATGCACCCTCACTCTTCTTGGGATCGGTGAAAATCTTGAGCGTG

hide sequence

Protein Sequences


Protein RefSeqs	XP_008769163	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM02518	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

XP_008769163 ⟸ XM_008770941

- UniProtKB:

A0A8I6AEZ4 (UniProtKB/TrEMBL), A6HUF5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGLVRWGLLLGCLGCGILLGARAQFPRVCMTLDGVLNKECCPPLGPEANNICGFLDGRGQCTEV
QTDTRPWSGPYVLRNQDDREQWPRKFFNRTCKCTGNFAGYNCGGCKFGWTGPDCNQKKPPVLRQ
NIHSLTAQEREQFLSALDLAKKTIHPDYVITTQHWLGLLGPNGTQPQIANCSVYDFFVWLHYYS
VRDTLLGPGRPYKAIDFSHQGPAFVTWHRYHLLWLERELQRLIGNESFALPYWNFATGKNECDV
CTDELLGAARQDDPTLISQNSRFSTWEIVCDSLDDYNRRVTLCNGTYEGLLRRNKVGRNNETLP
TLKNVQDCLSLQEFDSPPFFQNSTFSFRNALEGFDKADGTLDSQVMNLHNLAHSFLNGTNALPH
SAANDPVFVVLHSFTDAIFDEWLRKNNPSTDAWPQELAPIGHNRMYNMVPFFPPVTNEELFLTA
DQLGYNYAIDLSVEEAPVWTTTLSVXIGILGVLLESWRFCFLHYRRLRKGYAPXMETGLSSKRY
TEEA

hide sequence

Protein Domains

Tyrosinase copper-binding

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564975	AgrOrtholog
BioCyc Gene	G2FUF-12461	BioCyc
BioCyc Pathway	PWY-6498 [eumelanin biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000008671	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000086887	ENTREZGENE
	ENSRNOP00000086887.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000076707	ENTREZGENE
	ENSRNOT00000076707.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.1280.10	UniProtKB/TrEMBL
InterPro	Di-copper_centre_dom_sf	UniProtKB/TrEMBL
	Tyrosinase_Cu-bd	UniProtKB/TrEMBL
NCBI Gene	290484	ENTREZGENE
PANTHER	L-DOPACHROME TAUTOMERASE	UniProtKB/TrEMBL
	TYROSINASE FAMILY MEMBER	UniProtKB/TrEMBL
Pfam	Tyrosinase	UniProtKB/TrEMBL
PhenoGen	Dct	PhenoGen
PRINTS	TYROSINASE	UniProtKB/TrEMBL
PROSITE	TYROSINASE_1	UniProtKB/TrEMBL
	TYROSINASE_2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48056	UniProtKB/TrEMBL
UniProt	A0A8I6AEZ4	ENTREZGENE, UniProtKB/TrEMBL
	A6HUF5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-05	Dct	dopachrome tautomerase	Dct	dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Dct	dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)	Dct	dopachrome tautomerase	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Dct	dopachrome tautomerase	RGD1564975_predicted	similar to Dopachrome tautomerase (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564975_predicted	similar to Dopachrome tautomerase (predicted)	LOC290484	similar to Dopachrome tautomerase	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC290484	similar to Dopachrome tautomerase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)