Nkx1-1 (NK1 homeobox 1) - Rat Genome Database

Name: Nkx1-1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Nkx1-1 (NK1 homeobox 1) Rattus norvegicus

Analyze

Symbol:

Nkx1-1

Name:

NK1 homeobox 1

RGD ID:

1564874

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in cell differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including nervous system process; regulation of generation of precursor metabolites and energy; and regulation of glucose metabolic process. Predicted to be active in nucleus. Orthologous to human NKX1-1 (NK1 homeobox 1); INTERACTS WITH bisphenol A; 4,4'-sulfonyldiphenol (ortholog); isoflurane (ortholog).

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

LOC298981; NK1 transcription factor related, locus 1; NK1 transcription factor related, locus 1 (Drosophila); NK1 transcription factor-related protein 1; RGD1564874; similar to homeodomain protein Sax2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NKX1-1 (NK1 homeobox 1)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Nkx1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nkx1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NKX1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NKX1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nkx1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NKX1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nkx1-1 (NK1 homeobox 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nkx1-1 (NK1 homeobox 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NKX1-1 (NK1 homeobox 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	slou	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nkx1-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	81,521,206 - 81,524,788 (+)	NCBI		GRCr8
mRatBN7.2	14	77,296,676 - 77,300,575 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	77,296,796 - 77,300,036 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	14	82,603,538 - 82,607,031 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	82,603,671 - 82,607,031 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	83,287,754 - 83,291,039 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	83,216,329 - 83,219,569 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	76,215,871 - 76,219,364 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cherubism (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (ISO)

bisphenol A (EXP)

isoflurane (ISO)

titanium dioxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IBA)

lipid metabolic process (ISO)

nervous system process (ISO)

regulation of generation of precursor metabolites and energy (ISO)

regulation of glucose metabolic process (ISO)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

nucleus (IBA)

Molecular Function

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17879320	PMID:21126319

Genomics

Comparative Map Data

Nkx1-1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	81,521,206 - 81,524,788 (+)	NCBI		GRCr8
mRatBN7.2	14	77,296,676 - 77,300,575 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	77,296,796 - 77,300,036 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	14	82,603,538 - 82,607,031 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	82,603,671 - 82,607,031 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	83,287,754 - 83,291,039 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	83,216,329 - 83,219,569 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	14	76,215,871 - 76,219,364 (+)	NCBI		Celera
Cytogenetic Map	14	q21	NCBI

NKX1-1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	1,402,932 - 1,406,442 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	1,402,932 - 1,406,442 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	1,396,720 - 1,400,230 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	1,380,072 - 1,392,453 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	4	1,324,669 - 1,339,840 (-)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	1,366,669 - 1,377,571 (-)	NCBI		HuRef
CHM1_1	4	1,396,490 - 1,400,000 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	1,401,206 - 1,404,716 (-)	NCBI		T2T-CHM13v2.0

Nkx1-1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	33,588,078 - 33,591,434 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	33,588,078 - 33,591,320 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	33,430,734 - 33,434,090 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	33,430,734 - 33,433,976 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	33,773,383 - 33,776,625 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	33,773,383 - 33,776,625 (-)	NCBI		MGSCv36	mm8
Celera	5	30,909,910 - 30,913,492 (-)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	17.65	NCBI

Nkx1-1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955514	763,160 - 781,635 (-)	NCBI	ChiLan1.0	ChiLan1.0

NKX1-1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	1,736,687 - 1,740,204 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	1,703,817 - 1,707,333 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	1,547,939 - 1,551,457 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	1,423,117 - 1,430,833 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

NKX1-1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	62,634,654 - 62,638,111 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	62,634,783 - 62,638,111 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	65,150,929 - 65,154,386 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	63,109,511 - 63,112,971 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	63,109,640 - 63,112,971 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	62,601,641 - 62,605,099 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	62,805,130 - 62,808,591 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	63,164,504 - 63,167,959 (+)	NCBI		UU_Cfam_GSD_1.0

Nkx1-1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	68,207,850 - 68,209,154 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936477	21,909,542 - 21,910,599 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NKX1-1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	608,098 - 611,859 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	608,327 - 611,859 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Nkx1-1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	25,897,061 - 25,899,884 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624755	25,896,953 - 25,900,096 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nkx1-1
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	167
Count of miRNA genes:	94
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000057911, ENSRNOT00000073177
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30320092	80829842	Rat
2313048	Bss84	Bone structure and strength QTL 84	3.1	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	14	37669719	82669719	Rat
2313084	Bss83	Bone structure and strength QTL 83	2.9	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	14	37669719	82669719	Rat
2313089	Bss81	Bone structure and strength QTL 81	3.4	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	14	37669719	82669719	Rat
2313100	Bss82	Bone structure and strength QTL 82	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	14	37669719	82669719	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39057237	83368335	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	40793460	98037301	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42262529	95023211	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	50023211	95023211	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	55147478	100147478	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	55624247	100624247	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	55624247	100624247	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	56631369	101631369	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	58184885	103184885	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	68757796	83368335	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	70053989	104886043	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	70053989	104886043	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	73415323	92554092	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	92554092	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	73415323	92554092	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	73415323	95876975	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	musculoskeletal system	nervous system	reproductive system	respiratory system
High
Medium
Low		5	4
Below cutoff	1	18	11	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_001065657	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_234082	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000073177 ⟹ ENSRNOP00000064746

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	77,296,796 - 77,300,036 (+)	Ensembl
Rnor_6.0 Ensembl	14	82,603,671 - 82,607,031 (+)	Ensembl

RefSeq Acc Id:

XM_234082 ⟹ XP_234082

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	81,521,206 - 81,524,788 (+)	NCBI
mRatBN7.2	14	77,296,676 - 77,300,575 (+)	NCBI
Rnor_6.0	14	82,603,538 - 82,607,031 (+)	NCBI
Rnor_5.0	14	83,287,754 - 83,291,039 (+)	NCBI
RGSC_v3.4	14	83,216,329 - 83,219,569 (-)	RGD

Sequence:

show sequence

GCTACGCCAGGCAGCACTAGCCAAGCGGGACGCAGCGGCGAGAACTGCTAGGCTGAAGCTGATT
TTGCGGGGTGCAGGGATGGGATCCCAGTAGGTAGCGGGGCCCGAGCCGCCTGAGCGGCCCGAGG
CCGGCATGAGTACCAGCGGCCCGGCGGCACCTGGGGACATCCCCGCGCTGCCACCGCCACCGCC
ACCGCCCGAGCCCGGCTCCGGGCCCGCACCACCAGCTCCTGCGGCTACAGCTCGGGACGCTATG
GACGGACGAGCTGAGCTGCCCATCTTCCCCCGGGCTGGAGTCCCACCGCTAGCGGTTAGTGACA
CTGTGCCCGCGGTGCCAGACGGGGCTGGAGCAGCCCGGCCCGCCGCGCCCCCGCGCCCCACCTC
CTTCTCCGTGCTGGACATTCTAGATCCCAACAAGTTCAACAGTAGGAGACGCCGGTGCGTGCTC
CTGGGCCCCGTGGTGCCCGCTACGTGTGCCCCATGCGCCCCGGCCGCGTGCGTCCCGGTCCCCG
CTGCCTCCGGACGCTCGCCGCGCGCAGAGCTAGAACGCCGAGCCCTTTCCGCCGCCACAGGAGT
CGCCGCGGCCACGGGAGCTGAGCCTACAAGTACTGGGGACTCTTACAGGGCGGACGAGGCCGAG
GCCAACGGCTACAGCAGCGGCAGTGGTCGCAGCCCGACCGCGGACAGCGAGGATGAAGCGCCTG
AGGAGGACGAGGACGAGGACCAGGCGCCCGAGGTGCAGGATGTTCAGGGCACCGAGGAGCCTCG
GGGAGGCAGCGGCGGTCTCGGGGCCCGCGGGTCGGGTTGCTCCGGAGCGGCCGAGGTCGAGGCT
TCCCCGGTGGACGAGGCTGCGGCCCCAGGGCCCCGCGGGAACTCGCCCGGAGCCCCGGGCCCGC
CTGTAACTGCTGCGGGAGCGGGGAACGCGGGGAGCACCCCGCAGGGCGCCGCCGTGGCCACCAA
GCCCAAGCGGAAGCGCACGGGCTCGGACTCGAAGTCCGGGAAGCCGCGGCGTGCGCGCACCGCC
TTCACCTACGAGCAGCTCGTGGCGCTGGAGAACAAGTTTAAGGCCACTCGCTACCTGTCGGTGT
GCGAGCGCCTCAACCTGGCGCTGTCGCTGAGCCTCACGGAGACGCAGGTGAAGATCTGGTTCCA
GAACCGACGAACCAAGTGGAAGAAACAAAATCCTGGCGCTGACACCAGCGCGCCGACCGGCGGC
GGCGGGGGCCCGGGCCCGGGAGCGGGACCCGGCGCGGGGCTGCCCGGCGGCCTCAGTCCCCTCA
GCCCCTCGCCGCCCATGGGCGCGCCGCTCGCTTTGCACGGCCCGGCGGGGTACCCGGCGCATAG
TCCGGGAGGGCTGGTGTGCGCCGCGCAGCTGCCCTTCCTGTCCAGCCCGGCGGTGCTCTCGCCC
TTCGTGCTGGGCTCGCAGACGTACGGCGCGCCCGCCTTCTACGCGCCCCACCTCTGA

hide sequence

Protein Sequences


Protein RefSeqs	XP_234082	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064746
	ENSRNOP00000064746.3

RefSeq Acc Id:

XP_234082 ⟸ XM_234082

- UniProtKB:

M0R5R8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSTSGPAAPGDIPALPPPPPPPEPGSGPAPPAPAATARDAMDGRAELPIFPRAGVPPLAVSDTV
PAVPDGAGAARPAAPPRPTSFSVLDILDPNKFNSRRRRCVLLGPVVPATCAPCAPAACVPVPAA
SGRSPRAELERRALSAATGVAAATGAEPTSTGDSYRADEAEANGYSSGSGRSPTADSEDEAPEE
DEDEDQAPEVQDVQGTEEPRGGSGGLGARGSGCSGAAEVEASPVDEAAAPGPRGNSPGAPGPPV
TAAGAGNAGSTPQGAAVATKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCE
RLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADTSAPTGGGGGPGPGAGPGAGLPGGLSPLSP
SPPMGAPLALHGPAGYPAHSPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAPAFYAPHL

hide sequence

RefSeq Acc Id:

ENSRNOP00000064746 ⟸ ENSRNOT00000073177

Protein Domains

Homeobox

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R5R8-F1-model_v2	AlphaFold	M0R5R8	1-443	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564874	AgrOrtholog
BioCyc Gene	G2FUF-15257	BioCyc
Ensembl Genes	ENSRNOG00000005113	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000073177.3	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeobox_CS	UniProtKB/TrEMBL
	Homeobox_metazoa	UniProtKB/TrEMBL
	Homeodomain	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
NCBI Gene	298981	ENTREZGENE
PANTHER	HOMEOBOX PROTEIN NKX	UniProtKB/TrEMBL
	NK1 TRANSCRIPTION FACTOR-RELATED PROTEIN 1	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
PhenoGen	Nkx1-1	PhenoGen
PRINTS	HOMEOBOX	UniProtKB/TrEMBL
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005113	RatGTEx
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	M0R5R8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-14	Nkx1-1	NK1 homeobox 1	Nkx1-1	NK1 transcription factor related, locus 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-05	Nkx1-1	NK1 transcription factor related, locus 1 (Drosophila)	Nkx1-1	NK1 homeobox 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Nkx1-1	NK1 transcription factor related, locus 1 (Drosophila)	RGD1564874_predicted	similar to homeodomain protein Sax2 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1564874_predicted	similar to homeodomain protein Sax2 (predicted)	LOC298981	similar to homeodomain protein Sax2	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC298981	similar to homeodomain protein Sax2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar