Fahd2a (fumarylacetoacetate hydrolase domain containing 2A)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fahd2a (fumarylacetoacetate hydrolase domain containing 2A) Rattus norvegicus

Analyze

Symbol:

Fahd2a

Name:

fumarylacetoacetate hydrolase domain containing 2A

RGD ID:

1563674

Description:

Predicted to enable hydrolase activity and metal ion binding activity. Orthologous to human FAHD2A (fumarylacetoacetate hydrolase domain containing 2A) and FAHD2B (fumarylacetoacetate hydrolase domain containing 2B); INTERACTS WITH acrylamide (ortholog); all-trans-retinoic acid (ortholog); benzo[a]pyrene (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fahd2; fumarylacetoacetate hydrolase domain-containing protein 2; LOC296131; RGD1563674; similar to RIKEN cDNA B430104H02

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	114,657,176 - 114,665,349 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	114,655,865 - 114,665,356 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,546,518 - 118,554,707 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	127,142,077 - 127,150,266 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	124,802,450 - 124,810,639 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	120,003,215 - 120,011,392 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	120,002,364 - 120,011,364 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	127,321,203 - 127,329,383 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,939,359 - 114,947,515 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	113,495,646 - 113,503,802 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

intellectual disability (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

acrylamide (ISO)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

diazinon (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

catalytic activity (IEA)

hydrolase activity (IEA)

metal ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:18614015

Genomics

Comparative Map Data

Fahd2a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	114,657,176 - 114,665,349 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	114,655,865 - 114,665,356 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	118,546,518 - 118,554,707 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	127,142,077 - 127,150,266 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	124,802,450 - 124,810,639 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	120,003,215 - 120,011,392 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	120,002,364 - 120,011,364 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	127,321,203 - 127,329,383 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	114,939,359 - 114,947,515 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	113,495,646 - 113,503,802 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

FAHD2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	97,078,748 - 97,094,882 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	97,083,583 - 97,094,882 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	97,749,320 - 97,760,619 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	97,113,050 - 97,124,309 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	92,191,478 - 92,202,734 (-)	NCBI		Celera
Cytogenetic Map	2	q11.2	NCBI
HuRef	2	91,708,979 - 91,720,280 (-)	NCBI		HuRef
CHM1_1	2	97,754,277 - 97,765,535 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	97,587,843 - 97,601,480 (-)	NCBI		T2T-CHM13v2.0

FAHD2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	31,221,556 - 31,238,319 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	102,185,923 - 102,197,189 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

FAHD2A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	34,695,894 - 34,704,580 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	34,626,578 - 34,808,469 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	34,465,245 - 34,473,933 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	35,466,789 - 35,475,479 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	35,466,789 - 35,475,462 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	34,596,125 - 34,604,808 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	34,664,437 - 34,673,128 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	34,873,676 - 34,882,364 (-)	NCBI		UU_Cfam_GSD_1.0

FAHD2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	3	55,147,373 - 55,171,302 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Variants

Variants in Fahd2a
20 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	91
Count of miRNA genes:	78
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000018922
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
1582216	Bw65	Body weight QTL 65	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	102200529	115665732	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1331758	Bp207	Blood pressure QTL 207	2.848		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	112287552	135181505	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat

Markers in Region

RH142366

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	114,657,314 - 114,657,727 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	120,003,354 - 120,003,766	NCBI	Rnor6.0
Rnor_5.0	3	127,328,832 - 127,329,244	UniSTS	Rnor5.0
RGSC_v3.4	3	114,939,495 - 114,939,907	UniSTS	RGSC3.4
Celera	3	113,495,782 - 113,496,194	UniSTS
RH 3.4 Map	3	997.3	UniSTS
Cytogenetic Map	3	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	51	41	5	41		3	74	35	39	11
Low		8	6		14		8	8			2		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006234960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000018922 ⟹ ENSRNOP00000018922

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,656,065 - 114,665,356 (-)	Ensembl
Rnor_6.0 Ensembl	3	120,002,364 - 120,011,364 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000094091 ⟹ ENSRNOP00000085254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,655,865 - 114,665,356 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109233 ⟹ ENSRNOP00000079379

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,657,176 - 114,665,356 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000116219 ⟹ ENSRNOP00000080668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	114,658,175 - 114,665,343 (-)	Ensembl

RefSeq Acc Id:

NM_001134834 ⟹ NP_001128306

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	114,657,176 - 114,665,349 (-)	NCBI
Rnor_6.0	3	120,003,218 - 120,011,374 (-)	NCBI
Rnor_5.0	3	127,321,203 - 127,329,383 (+)	NCBI
RGSC_v3.4	3	114,939,359 - 114,947,515 (-)	RGD
Celera	3	113,495,646 - 113,503,802 (-)	RGD

Sequence:

show sequence

GGGGGTGGGGGTGCTATTTCCCTTGGAGAAGAGTTAAGTGCTTGCTTGCTACGCTCCTGGCTGT
GGCTTCTCTGCCCGCCCCTCTCGACCTGCAGCCTTGCAGGCATCGGCTCACTGCACAGGGAGCC
GGGTGGGTCCGGCCACAGCAAACAGGCTTTGATGCTGGGCTCTGGTAGAAGGAGGTTGCTGTCA
ACTCTGCTGCAGGTTCAGAAGAGGCCCTGTCAACCCTGCAGAAATATGAGACTGGTACAGTTCC
AGGCACCTCACCTGGAAGAGCCTCACGTGGGCCTAGAGTCAGGGATTGGTGGGGGAGTTGTAGA
CCTAAACACCTTTGACCCAGCGCTCCCCAAGACAATGGTGCAGTTCCTGGAGCGGGGAGAGACT
GCCCTTTCGGTGGCAAGAAGAGCCCTGGCTGCCCAGTTGCCACTCATCCCTCGGTCACAGGTGA
CCTTCTTAGCCCCTGTCACCCGGCCAGACAAGGTGATATGTGTGGGCTTGAATTATGCAGACCA
CTGTCAAGAACAGAACGTGCGGGTGCCCAAGAATCCCATCATCTTCAGCAAGTTCTCCAGCTCC
ATCGTGGGGCCCTATGACAGCATCATCCTCCCACCAGAGAGTAAGGAAGTTGACTGGGAGGTGG
AGATGGCCGTGGTCATTGGGAAGAAAGGCAAACACATCAAGGCCACAGATGTCATGGCTTACGT
GGCTGGCTTCACTGTGGCTCATGATGTGAGTGCTCGGGACTGGCAAATGAGAAATGGAAAGCAG
TGGTTACTGGGAAAAACTTTTGATACTTTCTGCCCCCTGGGCCCTGCCTTGGTTACCAAGGATA
CCATAGCAGATCCACACAATCTAAAGATCTCCTGTCGAGTGAATGGGGAGATTGTCCAGAGCAG
CAACACCAACCAGATGGTGTTCAAGACTGAAGATCTGATAGCCTGGGTCTCCCAGTTTGTCACT
CTGTACCCAGGGGACATTCTCCTGACTGGGACTCCTCCAGGTGTCGGCATGTTTAGGAAGCCTC
CTGTCTTTCTCAAGAAGGGTGATGAAGTCCAGTGTGAGATTGAAGAGCTTGGTGTCATCATCAA
CAAGGTGGTGTGATGGTGTCCTGTAAGCACTGGACTTGACACCAGGCAGAACTTGTGCTCCCAC
CCAGCTCACTGCTGGCCCTGCCTACTTAAGGCTGCTCTTAGGTAGGCCATGGGAATAAATTTTC
TCTCAAAGTTACAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001128306	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66933	(Get FASTA)	NCBI Sequence Viewer
	B2RYW9	(Get FASTA)	NCBI Sequence Viewer
	EDL80117	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001128306 ⟸ NM_001134834

- UniProtKB:

B2RYW9 (UniProtKB/Swiss-Prot), A6HQ16 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLGSGRRRLLSTLLQVQKRPCQPCRNMRLVQFQAPHLEEPHVGLESGIGGGVVDLNTFDPALPK
TMVQFLERGETALSVARRALAAQLPLIPRSQVTFLAPVTRPDKVICVGLNYADHCQEQNVRVPK
NPIIFSKFSSSIVGPYDSIILPPESKEVDWEVEMAVVIGKKGKHIKATDVMAYVAGFTVAHDVS
ARDWQMRNGKQWLLGKTFDTFCPLGPALVTKDTIADPHNLKISCRVNGEIVQSSNTNQMVFKTE
DLIAWVSQFVTLYPGDILLTGTPPGVGMFRKPPVFLKKGDEVQCEIEELGVIINKVV

hide sequence

RefSeq Acc Id:

ENSRNOP00000018922 ⟸ ENSRNOT00000018922

RefSeq Acc Id:

ENSRNOP00000079379 ⟸ ENSRNOT00000109233

RefSeq Acc Id:

ENSRNOP00000080668 ⟸ ENSRNOT00000116219

RefSeq Acc Id:

ENSRNOP00000085254 ⟸ ENSRNOT00000094091

Protein Domains

Fumarylacetoacetase-like C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RYW9-F1-model_v2	AlphaFold	B2RYW9	1-313	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563674	AgrOrtholog
BioCyc Gene	G2FUF-47991	BioCyc
BioCyc Pathway	TYRFUMCAT-PWY [L-tyrosine degradation I]	BioCyc
Ensembl Genes	ENSRNOG00000013974	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000018922.5	UniProtKB/TrEMBL
	ENSRNOP00000079379	ENTREZGENE
	ENSRNOP00000079379.1	UniProtKB/TrEMBL
	ENSRNOP00000080668.1	UniProtKB/TrEMBL
	ENSRNOP00000085254.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018922.8	UniProtKB/TrEMBL
	ENSRNOT00000094091.1	UniProtKB/TrEMBL
	ENSRNOT00000109233	ENTREZGENE
	ENSRNOT00000109233.1	UniProtKB/TrEMBL
	ENSRNOT00000116219.1	UniProtKB/TrEMBL
Gene3D-CATH	3.90.850.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6921785	IMAGE-MGC_LOAD
InterPro	Fumarylacetoacetase-like_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fumarylacetoacetase_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:296131	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188927	IMAGE-MGC_LOAD
NCBI Gene	296131	ENTREZGENE
PANTHER	FUMARYLACETOACETATE HYDROLASE DOMAIN-CONTAINING PROTEIN 2A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FUMARYLACETOACETATE HYDROLASE DOMAIN-CONTAINING PROTEIN 2A-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	FAA_hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fahd2a	PhenoGen
Superfamily-SCOP	SSF56529	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZMZ1_RAT	UniProtKB/TrEMBL
	A0A8I5ZQK0_RAT	UniProtKB/TrEMBL
	A0A8I5ZZS1_RAT	UniProtKB/TrEMBL
	A0A8L2Q9F8_RAT	UniProtKB/TrEMBL
	A6HQ16	ENTREZGENE, UniProtKB/TrEMBL
	B2RYW9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Fahd2a	fumarylacetoacetate hydrolase domain containing 2A	Fahd2a_predicted	fumarylacetoacetate hydrolase domain containing 2A (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Fahd2a_predicted	fumarylacetoacetate hydrolase domain containing 2A (predicted)	RGD1563674_predicted	similar to RIKEN cDNA B430104H02 (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1563674_predicted	similar to RIKEN cDNA B430104H02 (predicted)	LOC296131	similar to RIKEN cDNA B430104H02	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC296131	similar to RIKEN cDNA B430104H02			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar