Dynlt2b (dynein light chain Tctex-type 2B)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Dynlt2b (dynein light chain Tctex-type 2B) Rattus norvegicus

Analyze

Symbol:

Dynlt2b

Name:

dynein light chain Tctex-type 2B

RGD ID:

1563597

Description:

Predicted to enable dynein intermediate chain binding activity. Predicted to be involved in cilium organization; regulation of cilium assembly; and regulation of intraciliary retrograde transport. Predicted to be part of cytoplasmic dynein complex. Predicted to colocalize with ciliary base and cytoskeleton. Human ortholog(s) of this gene implicated in asphyxiating thoracic dystrophy. Orthologous to human DYNLT2B (dynein light chain Tctex-type 2B); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

dynein light chain Tctex-type protein 2B; LOC498095; RGD1563597; similar to RIKEN cDNA 0610012D17; Tctex1 domain containing 2; tctex1 domain-containing protein 2; Tctex1d2

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	68,359,138 - 68,367,573 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,358,263 - 68,367,499 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	77,196,193 - 77,204,553 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	69,860,905 - 69,869,271 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	68,885,307 - 68,893,667 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	71,593,302 - 71,601,662 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	71,593,302 - 71,601,662 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	74,678,025 - 74,686,385 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	70,175,484 - 70,183,844 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	67,791,755 - 67,800,115 (-)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

asphyxiating thoracic dystrophy (ISO)

asphyxiating thoracic dystrophy 3 (ISO)

autistic disorder (ISO)

chromosome 3q29 microdeletion syndrome (ISO)

schizophrenia (ISO)

Short-Rib Thoracic Dysplasia 17 with or without Polydactyly (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-methylcholine (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

choline (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

dibutyl phthalate (ISO)

dimethylselenide (ISO)

ethanol (ISO)

folic acid (ISO)

furan (EXP)

hydroxyl (ISO)

L-methionine (ISO)

methimazole (EXP)

nitrofen (EXP)

ozone (ISO)

quercetin (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cilium assembly (ISO)

intraciliary retrograde transport (ISO)

regulation of cilium assembly (ISO)

regulation of intraciliary retrograde transport (ISO)

Cellular Component

axoneme (ISO)

centrosome (ISO)

ciliary base (ISO)

cytoplasmic dynein complex (ISO)

interphase microtubule organizing center (ISO)

spindle pole (ISO)

Molecular Function

dynein intermediate chain binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:25205765	PMID:25830415	PMID:26044572

Genomics

Comparative Map Data

Dynlt2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	68,359,138 - 68,367,573 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,358,263 - 68,367,499 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	77,196,193 - 77,204,553 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	69,860,905 - 69,869,271 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	68,885,307 - 68,893,667 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	71,593,302 - 71,601,662 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	71,593,302 - 71,601,662 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	74,678,025 - 74,686,385 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	70,175,484 - 70,183,844 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	67,791,755 - 67,800,115 (-)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

DYNLT2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	196,291,219 - 196,318,240 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	196,291,219 - 196,318,299 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	196,018,090 - 196,045,111 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	197,502,495 - 197,529,542 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	194,599,369 - 194,625,623 (-)	NCBI		Celera
Cytogenetic Map	3	q29	NCBI
HuRef	3	193,315,227 - 193,342,065 (-)	NCBI		HuRef
CHM1_1	3	195,988,915 - 196,015,992 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	199,010,707 - 199,037,779 (-)	NCBI		T2T-CHM13v2.0

Dynlt2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	32,238,520 - 32,247,917 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	32,238,520 - 32,247,917 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	32,419,702 - 32,429,099 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	32,419,702 - 32,429,099 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	32,419,788 - 32,428,978 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	32,339,491 - 32,348,845 (+)	NCBI		MGSCv36	mm8
Celera	16	32,903,898 - 32,913,071 (+)	NCBI		Celera
Cytogenetic Map	16	B3	NCBI
cM Map	16	22.69	NCBI

Dynlt2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	12,515,195 - 12,528,861 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	12,515,195 - 12,528,863 (-)	NCBI	ChiLan1.0	ChiLan1.0

DYNLT2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	3	194,166,741 - 194,195,647 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	193,636,238 - 193,665,254 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	203,580,040 - 203,607,193 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	203,580,040 - 203,607,189 (-)	Ensembl	panpan1.1		panPan2

DYNLT2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	29,414,484 - 29,430,439 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	29,438,720 - 29,458,096 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	29,647,899 - 29,667,241 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	29,647,895 - 29,667,239 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	29,435,103 - 29,454,371 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	29,488,952 - 29,508,396 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	30,111,622 - 30,131,184 (-)	NCBI		UU_Cfam_GSD_1.0

Dynlt2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	124,930,228 - 124,944,969 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936784	940,168 - 955,412 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936784	940,300 - 954,959 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PCYT1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	133,774,574 - 133,800,038 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	133,774,548 - 133,798,920 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

DYNLT2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	90,867,250 - 90,902,064 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	90,867,322 - 90,902,667 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	64,689,281 - 64,716,174 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dynlt2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	61,467,510 - 61,479,756 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	61,467,262 - 61,479,848 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dynlt2b
21 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	303
Count of miRNA genes:	201
Interacting mature miRNAs:	227
Transcripts:	ENSRNOT00000002397
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	66113321	82169223	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	66422148	86241447	Rat
1354593	Stl12	Serum triglyceride level QTL 12	3.36		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	11	66422148	86241447	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		12	7	6		6			74	35	41	11
Low	3	31	50	35	19	35	8	11					8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000002397 ⟹ ENSRNOP00000002397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,359,138 - 68,367,499 (-)	Ensembl
Rnor_6.0 Ensembl	11	71,593,302 - 71,601,662 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102459 ⟹ ENSRNOP00000095089

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,359,339 - 68,367,499 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000106782 ⟹ ENSRNOP00000078257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,358,263 - 68,367,499 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109280 ⟹ ENSRNOP00000097992

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,359,339 - 68,367,499 (-)	Ensembl

RefSeq Acc Id:

NM_001109054 ⟹ NP_001102524

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	11	68,359,138 - 68,367,499 (-)	NCBI
Rnor_6.0	11	71,593,302 - 71,601,662 (-)	NCBI
Rnor_5.0	11	74,678,025 - 74,686,385 (-)	NCBI
RGSC_v3.4	11	70,175,484 - 70,183,844 (-)	RGD
Celera	11	67,791,755 - 67,800,115 (-)	RGD

Sequence:

show sequence

TCTTGAGACCTGCTGGATCCAGACACAGAGATATGGCTGTGTCCGTCCGAGGCCAGTCCTTAAC
GGCTGGCGCCTCCGAGGGCCTGTCCGAGGCCGACAAGACCTCAGGGGAGCCTGAGAACACCTAT
ATTCTGAGGCCCATTTTCCAGCAAAGGTTTAGACCCTCTGTGGTTAAAGACTGCATCCATACTG
TGCTCAAGGAAGAACTGACAGGTGCTGAATATTCTCCAGAAGAAATGCCTCAACTCACAAAACG
TCTATCAGAAATGATTAAAGATAAGCTAAAAGAATTGGGATATGACCGGTATAAAATGGTGGTG
CAGGTGGTGATTGGAGAACAGAGGGGTGAAGGAGTATTCATGGCTGCTCGCTGTTTCTGGGATG
CAGACACAGACAACTACACTCATGATGTTTTCATGAATGACAGCTTATTCTGTGTTGTGGCAGC
ATTTGGCTGTTTCTACTACTGAATCTTTGGAAAGTGACTGTGACTTCGAGGAAACCTTAACTTT
TTTTTTCTTTATTCTTTTTTTCGGAGCTGGCGACGGAACCCAGGACCTTGCGCTTGCTAGGCAA
GCGCTCTACCACTGAGCTAAATCCCCAACCCCAAACCTTAACTTTTTTATATTGTTAGATTTCC
TGACCAAATAAAAAAGCTGGCACTTTGGTACCTAAAATCTGTTAAGTTTTATATGTTTAAATGG
TTTGATTTTATTTTCCTATCTGTGTCCTTTCTACATTTGGAAAAAGTAGAGAAAAGGGAGGGGA
AAATTCATTTTCATATTTCAGGTGACTAGATACTTGGGTATATTTTTTATTTATTGTTCCTTAT
AAGATGTAAAAAAAAATCATATATAAAATAAATTGTGTGTCTTCACCCCTT

hide sequence

RefSeq Acc Id:

XM_039088578 ⟹ XP_038944506

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	11	68,360,387 - 68,367,573 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102524	(Get FASTA)	NCBI Sequence Viewer
	XP_038944506	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11419	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001102524 ⟸ NM_001109054
- UniProtKB:	D4ADI6 (UniProtKB/TrEMBL), A6IRR7 (UniProtKB/TrEMBL), A0A8I6ASY5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVSVRGQSLTAGASEGLSEADKTSGEPENTYILRPIFQQRFRPSVVKDCIHTVLKEELTGAEY SPEEMPQLTKRLSEMIKDKLKELGYDRYKMVVQVVIGEQRGEGVFMAARCFWDADTDNYTHDVF MNDSLFCVVAAFGCFYY hide sequence

RefSeq Acc Id:

ENSRNOP00000002397 ⟸ ENSRNOT00000002397

RefSeq Acc Id:	XP_038944506 ⟸ XM_039088578
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6APP9 (UniProtKB/TrEMBL), A6IRR8 (UniProtKB/TrEMBL), A6IRS0 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000078257 ⟸ ENSRNOT00000106782

RefSeq Acc Id:

ENSRNOP00000097992 ⟸ ENSRNOT00000109280

RefSeq Acc Id:

ENSRNOP00000095089 ⟸ ENSRNOT00000102459

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563597	AgrOrtholog
BioCyc Gene	G2FUF-21093	BioCyc
Ensembl Genes	ENSRNOG00000001758	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000002397	ENTREZGENE
	ENSRNOP00000002397.5	UniProtKB/TrEMBL
	ENSRNOP00000078257.1	UniProtKB/TrEMBL
	ENSRNOP00000095089	ENTREZGENE
	ENSRNOP00000095089.1	UniProtKB/TrEMBL
	ENSRNOP00000097992.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002397	ENTREZGENE
	ENSRNOT00000002397.6	UniProtKB/TrEMBL
	ENSRNOT00000102459	ENTREZGENE
	ENSRNOT00000102459.1	UniProtKB/TrEMBL
	ENSRNOT00000106782.1	UniProtKB/TrEMBL
	ENSRNOT00000109280.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.1140.40	UniProtKB/TrEMBL
InterPro	Tctex	UniProtKB/TrEMBL
	Tctex-1-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:498095	UniProtKB/TrEMBL
NCBI Gene	498095	ENTREZGENE
PANTHER	DYNEIN LIGHT CHAIN TCTEX-TYPE PROTEIN 2B	UniProtKB/TrEMBL
	Tctex	UniProtKB/TrEMBL
Pfam	Tctex-1	UniProtKB/TrEMBL
PhenoGen	Dynlt2b	PhenoGen
UniProt	A0A8I6APP9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ASY5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G2I0_RAT	UniProtKB/TrEMBL
	A6IRR7	ENTREZGENE, UniProtKB/TrEMBL
	A6IRR8	ENTREZGENE, UniProtKB/TrEMBL
	A6IRS0	ENTREZGENE, UniProtKB/TrEMBL
	D4ADI6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-09-08	Dynlt2b	dynein light chain Tctex-type 2B	Tctex1d2	Tctex1 domain containing 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Tctex1d2	Tctex1 domain containing 2	RGD1563597_predicted	similar to RIKEN cDNA 0610012D17 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563597_predicted	similar to RIKEN cDNA 0610012D17 (predicted)	LOC498095	similar to RIKEN cDNA 0610012D17	Symbol and Name status set to approved	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM