Qpct (glutaminyl-peptide cyclotransferase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Qpct (glutaminyl-peptide cyclotransferase) Rattus norvegicus

Analyze

Symbol:

Qpct

Name:

glutaminyl-peptide cyclotransferase

RGD ID:

1562284

Description:

Predicted to enable glutaminyl-peptide cyclotransferase activity and zinc ion binding activity. Predicted to be involved in peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase. Orthologous to human QPCT (glutaminyl-peptide cyclotransferase); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3H-1,2-dithiole-3-thione.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glutaminyl cyclase; glutaminyl-peptide cyclotransferase (glutaminyl cyclase); glutaminyl-peptide cyclotransferase-like 1; hypothetical protein LOC313837; LOC313837; Qpctl1; RGD1562284; similar to Glutaminyl-peptide cyclotransferase precursor (QC); similar to Glutaminyl-peptide cyclotransferase precursor (QC) (Glutaminyl-tRNA cyclotransferase) (Glutaminyl cyclase); uncharacterized protein LOC313837

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	QPCT (glutaminyl-peptide cyclotransferase)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Qpct (glutaminyl-peptide cyclotransferase (glutaminyl cyclase))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Qpct (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	QPCT (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	QPCT (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Qpct (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	QPCT (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	QPCT (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Qpct (glutaminyl-peptide cyclotransferase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PRLHR (prolactin releasing hormone receptor)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	QPCT (glutaminyl-peptide cyclotransferase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Qpct (glutaminyl-peptide cyclotransferase (glutaminyl cyclase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	qpct (glutaminyl-peptide cyclotransferase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	H27A22.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG32413	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG6168	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	QC	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	YFR018C	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	isoQC	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	qpct	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	15,964,656 - 15,996,925 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	15,964,657 - 15,996,711 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	16,280,262 - 16,313,568 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	16,602,485 - 16,635,791 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	16,083,483 - 16,116,422 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	1,657,110 - 1,689,575 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	1,657,331 - 1,689,559 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	1,647,419 - 1,679,764 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	1,845,425 - 1,878,423 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	15,630,306 - 15,661,878 (-)	NCBI		Celera
Cytogenetic Map	6	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic contact dermatitis (ISO)

B-Cell Chronic Lymphocytic Leukemia (ISO)

genetic disease (ISO)

melanoma (ISO)

RASopathy (ISO)

septic arthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3H-1,2-dithiole-3-thione (EXP)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aldrin (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

bexarotene (EXP)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

carmustine (ISO)

choline (ISO)

cisplatin (ISO)

clofibrate (EXP)

clothianidin (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

diethylstilbestrol (EXP)

diuron (EXP)

doxorubicin (ISO)

ethanol (ISO)

fenofibrate (EXP)

folic acid (ISO)

gemfibrozil (EXP)

hydrogen peroxide (ISO)

hydroquinone (ISO)

L-methionine (ISO)

lead(0) (ISO)

lead(2+) (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel sulfate (ISO)

nitrofen (EXP)

oxaliplatin (EXP)

pentanal (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP,ISO)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

ritodrine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (EXP)

succimer (ISO)

sulforaphane (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloroethene (ISO)

tetrachloromethane (ISO)

topotecan (EXP)

triclosan (ISO)

trimellitic anhydride (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase (IBA,ISO)

Molecular Function

glutaminyl-peptide cyclotransferase activity (IBA,ISO)

protein binding (ISO)

zinc ion binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Glutaminyl cyclases as novel targets for the treatment of septic arthritis.	Hellvard A, etal., J Infect Dis. 2013 Mar 1;207(5):768-77. doi: 10.1093/infdis/jis729. Epub 2012 Nov 29.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:7999256	PMID:21288892	PMID:23376485	PMID:23533145	PMID:25002582

Genomics

Comparative Map Data

Qpct
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	15,964,656 - 15,996,925 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	15,964,657 - 15,996,711 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	16,280,262 - 16,313,568 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	16,602,485 - 16,635,791 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	16,083,483 - 16,116,422 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	1,657,110 - 1,689,575 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	1,657,331 - 1,689,559 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	1,647,419 - 1,679,764 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	1,845,425 - 1,878,423 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	15,630,306 - 15,661,878 (-)	NCBI		Celera
Cytogenetic Map	6	q11	NCBI

QPCT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	37,344,630 - 37,373,322 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	37,342,827 - 37,373,322 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	37,571,773 - 37,600,465 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	37,425,257 - 37,453,969 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	37,483,519 - 37,512,115	NCBI
Celera	2	37,412,695 - 37,441,406 (+)	NCBI		Celera
Cytogenetic Map	2	p22.2	NCBI
HuRef	2	37,311,579 - 37,340,390 (+)	NCBI		HuRef
CHM1_1	2	37,501,200 - 37,529,906 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	37,351,621 - 37,380,410 (+)	NCBI		T2T-CHM13v2.0

Qpct
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	79,359,335 - 79,397,807 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	79,359,335 - 79,397,807 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	79,051,906 - 79,090,378 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	79,051,906 - 79,090,378 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	79,451,246 - 79,489,583 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	78,956,964 - 78,995,436 (+)	NCBI		MGSCv36	mm8
MGSCv36	17	78,307,076 - 78,344,882 (+)	NCBI		MGSCv36	mm8
Celera	17	83,366,401 - 83,403,264 (+)	NCBI		Celera
Cytogenetic Map	17	E3	NCBI

Qpct
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955441	5,138,477 - 5,168,455 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955441	5,138,477 - 5,168,056 (+)	NCBI	ChiLan1.0	ChiLan1.0

QPCT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	89,110,245 - 89,139,229 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	37,371,848 - 37,400,820 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	38,136,537 - 38,165,254 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	38,136,532 - 38,165,254 (+)	Ensembl	panpan1.1		panPan2

QPCT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	29,700,422 - 29,741,652 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	29,716,378 - 29,741,221 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	29,531,103 - 29,555,598 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	30,366,927 - 30,391,480 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	30,366,993 - 30,392,807 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	29,593,903 - 29,618,395 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	29,660,151 - 29,684,689 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	29,875,410 - 29,899,919 (+)	NCBI		UU_Cfam_GSD_1.0

Qpct
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	42,264,101 - 42,294,078 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936663	929,363 - 959,668 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936663	929,737 - 959,458 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

QPCT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	102,792,720 - 102,823,026 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	102,795,199 - 102,823,090 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	109,332,654 - 109,360,644 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

QPCT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	70,015,260 - 70,044,033 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	70,015,261 - 70,043,941 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	41,903,220 - 41,931,940 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Qpct
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	18,945,969 - 18,984,016 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	18,945,954 - 18,984,016 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Qpct
241 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	41
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000049672
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293706	Bmd20	Bone mineral density QTL 20	4.3	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	5074497	19988050	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
1358190	Ept1	Estrogen-induced pituitary tumorigenesis QTL 1	4.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	6	9843312	20338915	Rat
2292616	Ept15	Estrogen-induced pituitary tumorigenesis QTL 15	4.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	6	9843312	20338915	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat

Markers in Region

RH128088

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	15,964,967 - 15,965,183 (-)	MAPPER	mRatBN7.2
Rnor_6.0	6	1,689,048 - 1,689,263	NCBI	Rnor6.0
Rnor_5.0	6	1,679,237 - 1,679,452	UniSTS	Rnor5.0
RGSC_v3.4	6	1,877,742 - 1,877,957	UniSTS	RGSC3.4
Celera	6	15,630,166 - 15,630,381	UniSTS
Cytogenetic Map	6	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			18	18		18			30		5	7
Low	3	41	35	19	18	19	8	10	40	33	36	4	8
Below cutoff		2	4	4	1	4		1	4	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399516	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006239632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF039308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000049672 ⟹ ENSRNOP00000045568

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	15,964,657 - 15,996,711 (-)	Ensembl
Rnor_6.0 Ensembl	6	1,657,331 - 1,689,559 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000079864 ⟹ ENSRNOP00000072958

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	15,964,657 - 15,996,699 (-)	Ensembl
Rnor_6.0 Ensembl	6	1,657,332 - 1,689,123 (+)	Ensembl

RefSeq Acc Id:

NM_001134557 ⟹ NP_001128029

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	15,965,108 - 15,996,699 (-)	NCBI
Rnor_6.0	6	1,657,332 - 1,689,123 (+)	NCBI
Rnor_5.0	6	1,647,419 - 1,679,764 (+)	NCBI
RGSC_v3.4	6	1,845,425 - 1,878,423 (+)	RGD
Celera	6	15,630,306 - 15,661,878 (-)	NCBI

Sequence:

show sequence

ATGGCAGGCGGCGAAGACAGGCGCGTCGTGGGCACCCGCCACCTGCTGCTGCTGGCGACCATCC
TGTCCCTGACAGCCGGGATTCTGAGTCCGGTCTCCGCTGTTGCCTGGACGCAGGAGAAGCACAT
CATGCAGCGAATTCAGAGACTTCAGGCTGAGTGGGTCGTGGAAGTCGACACCTTCCTCAGTAGG
ACGCCCTACGGATATCGGTCCTTCTCAAATATCATCAGCACCCTTAATCCGGAAGCGAAACGAC
ACCTGGTCCTTGCCTGCCACTATGACTCCAAATACTTTCCTCAATGGGACAGCAGAGTGTTTGT
GGGAGCCACTGATTCAGCCGTGCCGTGCGCAATGATGTTGGAACTCGCTCGTGCCTTAGACAAG
AAACTCCATTCCTTGAAGGATGTCTCCGGTTCCAGGCCGGATCTCTCGCTCCGGCTAATTTTCT
TTGATGGGGAAGAGGCCTTTCTTCACTGGTCTCCTCAAGATTCTCTGTATGGGTCTCGGCACTT
AGCTCAGAAGATGGCATCAAGCCCTCACCCTCCTGGATCAAGAGGCACCAACCAACTGGATGGC
ATGGATCTGTTGGTCTTACTGGATTTAATTGGAGCAGCAAATCCAACATTTCCTAATTTTTTCC
CCAAGACTACCAGATGGTTTACTAGACTTCAAGCAATTGAACAGCAGCTCTCTGAGTTGGGTTT
ACTCAAGGATCATTCTTTGGAGAGGAAATATTTTCAGAATTTTGGTTATGGAAATATTATCCAG
GATGACCACATTCCATTTTTAAGAAAAGGTGTCCCAGTTCTTCACCTGATAGCTTCTCCTTTCC
CTGAAGTCTGGCACACCATGGATGACAATGAAGAAAATCTGCACTCGTCAACCATTGACAATCT
CAACAAAATCATTCAGGTCTTTGTGTTGGAATATCTTCACTTGTAA

hide sequence

RefSeq Acc Id:

XM_006239632 ⟹ XP_006239694

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	15,964,656 - 15,996,925 (-)	NCBI
Rnor_6.0	6	1,657,110 - 1,689,575 (+)	NCBI
Rnor_5.0	6	1,647,419 - 1,679,764 (+)	NCBI

Sequence:

show sequence

CGTGTCACCAAGGGAAGCCCAGTCCCCTGGCTTGCAGGCTTCTCGGAGAGGAGCAGTGCTGGTT
TGTGCTAGCGCAGCGCAGCGGGAGGCCACAGGAGGCGACTGGGAGGCAGACAGTCAACCCAGGG
GTGGAGAAGAGGGAAGGCAGGGCGACCGGCGCGCGTTCCCGGGCTCGTGACCGCCGGCGGCCCC
GGGAATCCGCGCCCACACATTCTTGCAGAGATGGCAGGCGGCGAAGACAGGCGCGTCGTGGGCA
CCCGCCACCTGCTGCTGCTGGCGACCATCCTGTCCCTGACAGCCGGGATTCTGAGTCCGGTCTC
CGCTGTTGCCTGGACGCAGGAGAAGAACTACCACCAACCAGCACATCTGAATTCTTCATCTCTT
CGACAAGTGGCAGAAGCCACCAGCATTTCTGAGATGTGGCAAAATGACTTGAGACCACTGCTGA
TAGAACGATATCCTGGATCGCCCGGAAGCTATTCTGCTCGTCAGCACATCATGCAGCGAATTCA
GAGACTTCAGGCTGAGTGGGTCGTGGAAGTCGACACCTTCCTCAGTAGGACGCCCTACGGATAT
CGGTCCTTCTCAAATATCATCAGCACCCTTAATCCGGAAGCGAAACGACACCTGGTCCTTGCCT
GCCACTATGACTCCAAATACTTTCCTCAATGGGACAGCAGAGTGTTTGTGGGAGCCACTGATTC
AGCCGTGCCGTGCGCAATGATGTTGGAACTCGCTCGTGCCTTAGACAAGAAACTCCATTCCTTG
AAGGATGTCTCCGGTTCCAGGCCGGATCTCTCGCTCCGGCTAATTTTCTTTGATGGGGAAGAGG
CCTTTCTTCACTGGTCTCCTCAAGATTCTCTGTATGGGTCTCGGCACTTAGCTCAGAAGATGGC
ATCAAGCCCTCACCCTCCTGGATCAAGAGGCACCAACCAACTGGATGGCATGGATCTGTTGGTC
TTACTGGATTTAATTGGAGCAGCAAATCCAACATTTCCTAATTTTTTCCCCAAGACTACCAGAT
GGTTTACTAGACTTCAAGCAATTGAACAGCAGCTCTCTGAGTTGGGTTTACTCAAGGATCATTC
TTTGGAGAGGAAATATTTTCAGAATTTTGGTTATGGAAATATTATCCAGGATGACCACATTCCA
TTTTTAAGAAAAGGTGTCCCAGTTCTTCACCTGATAGCTTCTCCTTTCCCTGAAGTCTGGCACA
CCATGGATGACAATGAAGAAAATCTGCACTCGTCAACCATTGACAATCTCAACAAAATCATTCA
GGTCTTTGTGTTGGAATATCTTCACTTGTAATATGTGAATTTAGTTTCTGGTAATTGCTTCTGC
AACAACTTCAAGACATCGTTTAAACCATCTGACGCCAGATAAATGTTGTGTGTCCTATAGATTC
ATTCTGTAGGTGTCTTTGAATATGCGGTCAGCAAATTGTAGAATTCTATGACGCCCTCACTAAG
TTTCCTCTAGAGACAAGAAACATGTAAAGAAATAAAAAATAATTTTTGAAACTCTTTTGGATGA
AAACTTTAAAATGACATTAGATTCACTTACCAATGCCATAGAATTGCAAACAATTCTTAAGTAC
AATGACGTTGTACTGTATAGTGGTAGTTTTATATGTGACGTTATATAGTGTGTTATATAATATG
TAATGAAACACAGACATGTACTTTGACAGTCCTAAAGTTTCTTTTAGAAAAGCTTTGTGGAGTT
TATTTCTTGGGAATTAAAGTCTAAATTAAATTGTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001128029	(Get FASTA)	NCBI Sequence Viewer
	NP_001386445	(Get FASTA)	NCBI Sequence Viewer
	XP_006239694	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC28781	(Get FASTA)	NCBI Sequence Viewer
	EDM02796	(Get FASTA)	NCBI Sequence Viewer
	EDM02797	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001128029 ⟸ NM_001134557

- UniProtKB:

A0A0G2K497 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGGEDRRVVGTRHLLLLATILSLTAGILSPVSAVAWTQEKHIMQRIQRLQAEWVVEVDTFLSR
TPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPQWDSRVFVGATDSAVPCAMMLELARALDK
KLHSLKDVSGSRPDLSLRLIFFDGEEAFLHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDG
MDLLVLLDLIGAANPTFPNFFPKTTRWFTRLQAIEQQLSELGLLKDHSLERKYFQNFGYGNIIQ
DDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHSSTIDNLNKIIQVFVLEYLHL

hide sequence

RefSeq Acc Id:	XP_006239694 ⟸ XM_006239632
- Peptide Label:	isoform X1
- UniProtKB:	D4AC85 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGGEDRRVVGTRHLLLLATILSLTAGILSPVSAVAWTQEKNYHQPAHLNSSSLRQVAEATSIS EMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTL NPEAKRHLVLACHYDSKYFPQWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSRPDL SLRLIFFDGEEAFLHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANP TFPNFFPKTTRWFTRLQAIEQQLSELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLH LIASPFPEVWHTMDDNEENLHSSTIDNLNKIIQVFVLEYLHL hide sequence

RefSeq Acc Id:

ENSRNOP00000072958 ⟸ ENSRNOT00000079864

RefSeq Acc Id:

ENSRNOP00000045568 ⟸ ENSRNOT00000049672

Protein Domains

Peptidase M28

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AC85-F1-model_v2	AlphaFold	D4AC85	1-362	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694362

Promoter ID:

EPDNEW_R4884

Type:

initiation region

Name:

Qpct_1

Description:

glutaminyl-peptide cyclotransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	1,657,320 - 1,657,380	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562284	AgrOrtholog
BioCyc Gene	G2FUF-38498	BioCyc
BioCyc Pathway	PWY-7942 [5-oxo-L-proline metabolism]	BioCyc
Ensembl Genes	ENSRNOG00000005705	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000045568	ENTREZGENE
	ENSRNOP00000045568.3	UniProtKB/TrEMBL
	ENSRNOP00000072958	ENTREZGENE
	ENSRNOP00000072958.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000049672	ENTREZGENE
	ENSRNOT00000049672.5	UniProtKB/TrEMBL
	ENSRNOT00000079864	ENTREZGENE
	ENSRNOT00000079864.2	UniProtKB/TrEMBL
Gene3D-CATH	Zn peptidases	UniProtKB/TrEMBL
InterPro	M28_QC_like	UniProtKB/TrEMBL
	Peptidase_M28	UniProtKB/TrEMBL, UniProtKB/TrEMBL
	QC/QCL	UniProtKB/TrEMBL
KEGG Report	rno:313837	UniProtKB/TrEMBL
NCBI Gene	313837	ENTREZGENE
PANTHER	GLUTAMINYL-PEPTIDE CYCLOTRANSFERASE	UniProtKB/TrEMBL
	PTHR12283	UniProtKB/TrEMBL
Pfam	Peptidase_M28	UniProtKB/TrEMBL
PhenoGen	Qpct	PhenoGen
Superfamily-SCOP	Zn-dependent exopeptidases	UniProtKB/TrEMBL
UniProt	A0A0G2K497	ENTREZGENE, UniProtKB/TrEMBL
	D4AC85	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-18	Qpct	glutaminyl-peptide cyclotransferase	Qpctl1	glutaminyl-peptide cyclotransferase-like 1	Data Merged	737654	APPROVED
2013-11-25	Qpctl1	glutaminyl-peptide cyclotransferase-like 1	Qpct	glutaminyl-peptide cyclotransferase	Name and Symbol changed	629549	APPROVED
2013-11-25	Qpct	glutaminyl-peptide cyclotransferase	RGD1562284	similar to Glutaminyl-peptide cyclotransferase precursor (QC)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-20	Qpct	glutaminyl-peptide cyclotransferase	Qpct	glutaminyl-peptide cyclotransferase (glutaminyl cyclase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1562284	similar to Glutaminyl-peptide cyclotransferase precursor (QC)	RGD1562284_predicted	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-10	RGD1562284_predicted	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (predicted)	RGD1562284_predicted	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (Glutaminyl-tRNA cyclotransferase) (Glutaminyl cyclase) (predicted)	Name updated	1299863	APPROVED
2006-03-10	RGD1562284_predicted	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (predicted)		similar to Glutaminyl-peptide cyclotransferase precursor (QC) (Glutaminyl-tRNA cyclotransferase) (Glutaminyl cyclase) (predicted)	Name updated	1299863	APPROVED
2006-03-07	RGD1562284_predicted	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (Glutaminyl-tRNA cyclotransferase) (Glutaminyl cyclase) (predicted)	LOC313837	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (Glutaminyl-tRNA cyclotransferase) (Glutaminyl cyclase)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC313837	similar to Glutaminyl-peptide cyclotransferase precursor (QC) (Glutaminyl-tRNA cyclotransferase) (Glutaminyl cyclase)			Symbol and Name status set to provisional	70820	PROVISIONAL
2004-09-10	Qpct	glutaminyl-peptide cyclotransferase (glutaminyl cyclase)	Qpct	glutaminyl cyclase	Name updated	1299863	APPROVED
2004-09-10	Qpct	glutaminyl-peptide cyclotransferase (glutaminyl cyclase)		glutaminyl cyclase	Name updated	1299863	APPROVED
2002-08-07	Qpct	glutaminyl cyclase			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD