Wnt16 (Wnt family member 16) - Rat Genome Database

Name: Wnt16
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wnt16 (Wnt family member 16) Rattus norvegicus

Analyze

Symbol:

Wnt16

Name:

Wnt family member 16

RGD ID:

1562253

Description:

Predicted to enable cytokine activity and frizzled binding activity. Predicted to be involved in several processes, including keratinocyte proliferation; oxidative stress-induced premature senescence; and positive regulation of intracellular signal transduction. Predicted to act upstream of or within bone remodeling and cardiac epithelial to mesenchymal transition. Predicted to be located in cytoplasm. Predicted to be active in extracellular space. Orthologous to human WNT16 (Wnt family member 16); PARTICIPATES IN Wnt signaling pathway; Wnt signaling, canonical pathway; basal cell carcinoma pathway; INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

protein Wnt-16; wingless-related MMTV integration site 16; wingless-type MMTV integration site family, member 16

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT16 (Wnt family member 16)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Wnt16 (wingless-type MMTV integration site family, member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt16 (Wnt family member 16)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	WNT16 (Wnt family member 16)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt16 (wingless-type MMTV integration site family, member 16)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt16 (wingless-type MMTV integration site family, member 16)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-20	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	50,820,968 - 50,831,380 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	50,820,968 - 50,831,380 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	55,806,524 - 55,816,918 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	51,727,603 - 51,737,997 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	50,153,174 - 50,163,575 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	49,369,246 - 49,388,156 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	49,369,296 - 49,379,703 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	49,160,228 - 49,178,195 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	48,609,677 - 48,620,317 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	46,027,411 - 46,037,822 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

diarsenic trioxide (ISO)

folic acid (ISO)

irinotecan (ISO)

methimazole (EXP)

methotrexate (ISO)

paracetamol (ISO)

progesterone (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

bone remodeling (ISO)

canonical Wnt signaling pathway (IBA)

cardiac epithelial to mesenchymal transition (ISO)

cell fate commitment (IBA)

keratinocyte differentiation (ISO)

keratinocyte proliferation (ISO)

negative regulation of cell death (ISO)

neuron differentiation (IBA)

oxidative stress-induced premature senescence (ISO)

positive regulation of gene expression (ISO)

positive regulation of JNK cascade (ISO)

positive regulation of phosphatidylinositol 3-kinase signaling (ISO)

replicative senescence (ISO)

Cellular Component

cellular_component (ND)

cytoplasm (ISO)

extracellular space (IBA,ISO)

Molecular Function

cytokine activity (IBA)

frizzled binding (IBA)

molecular_function (ND)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
6.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.

Additional References at PubMed

PMID:10500199	PMID:15756456	PMID:16007226	PMID:17200136	PMID:19156209	PMID:19951988	PMID:22792071

Genomics

Comparative Map Data

Wnt16
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	50,820,968 - 50,831,380 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	50,820,968 - 50,831,380 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	55,806,524 - 55,816,918 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	4	51,727,603 - 51,737,997 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	4	50,153,174 - 50,163,575 (+)	NCBI	Rnor_WKY
Rnor_6.0	4	49,369,246 - 49,388,156 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	49,369,296 - 49,379,703 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	49,160,228 - 49,178,195 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	48,609,677 - 48,620,317 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	46,027,411 - 46,037,822 (+)	NCBI		Celera
Cytogenetic Map	4	q22	NCBI

WNT16
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	121,325,367 - 121,341,104 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	7	121,325,367 - 121,341,104 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	120,965,421 - 120,981,158 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	120,752,657 - 120,768,394 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	120,563,040 - 120,575,108	NCBI
Celera	7	115,774,608 - 115,790,350 (+)	NCBI		Celera
Cytogenetic Map	7	q31.31	NCBI
HuRef	7	115,328,649 - 115,344,394 (+)	NCBI		HuRef
CHM1_1	7	120,898,727 - 120,914,470 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	122,640,682 - 122,656,420 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	120,360,161 - 120,375,904 (+)	NCBI

Wnt16
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	22,288,179 - 22,298,521 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	22,288,226 - 22,298,521 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	22,288,178 - 22,298,522 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	22,288,227 - 22,298,522 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	22,238,227 - 22,248,522 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	22,238,231 - 22,248,523 (+)	NCBI		MGSCv36	mm8
Celera	6	22,342,361 - 22,352,644 (+)	NCBI		Celera
Cytogenetic Map	6	A3.1	NCBI

Wnt16
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955479	3,065,295 - 3,077,260 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955479	3,065,312 - 3,077,260 (+)	NCBI	ChiLan1.0	ChiLan1.0

WNT16
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	7	126,025,337 - 126,041,057 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	126,025,337 - 126,041,057 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	7	113,338,322 - 113,354,002 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

WNT16
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	59,388,034 - 59,404,812 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	59,387,846 - 59,396,622 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	58,802,351 - 58,811,862 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	59,417,524 - 59,431,676 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	59,422,183 - 59,431,814 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	59,515,494 - 59,524,990 (+)	NCBI		UMICH_Zoey_3.1
UU_Cfam_GSD_1.0	14	59,513,424 - 59,528,123 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt16
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	48,336,483 - 48,347,731 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936605	3,856,917 - 3,867,423 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936605	3,855,640 - 3,867,166 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT16
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	25,621,794 - 25,633,731 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	25,621,802 - 25,633,730 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	27,226,372 - 27,238,355 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT16
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	90,143,097 - 90,159,628 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	90,147,692 - 90,157,750 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	13,402,984 - 13,418,747 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt16
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624783	14,752,643 - 14,762,925 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624783	14,749,318 - 14,762,933 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt16
47 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	95
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000007822
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8655906	Rf60	Renal function QTL 60	3.8		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	4	29494195	81006281	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
11530004	Niddm71	Non-insulin dependent diabetes mellitus QTL 71		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	4	32584199	52754138	Rat
8552782	Vie1	Viral induced encephalitis QTL 1	26.4		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8552801	Bw143	Body weight QTL 143	7.3		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	34430484	82490359	Rat
8552809	Vie5	Viral induced encephalitis QTL 5	25.3		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	4	34430484	82490359	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
61475	Aia2	Adjuvant induced arthritis QTL 2	5.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	39505275	73892441	Rat
1331807	Rf31	Renal function QTL 31	2.988		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	4	39524264	74726312	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
61445	Strs3	Sensitivity to stroke QTL 3	3		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	4	40433388	85433388	Rat
8694439	Bw168	Body weight QTL 168	9.57	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	40433414	85433414	Rat
6893678	Bw108	Body weight QTL 108	2.6	0.006	body mass (VT:0001259)	body weight (CMO:0000012)	4	43457976	88457976	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
10450818	Scl76	Serum cholesterol level QTL 76	3.6	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	49178116	57114705	Rat
10450821	Scl77	Serum cholesterol level QTL 77	4.1	0.01	blood VLDL cholesterol amount (VT:0005144)	blood high density lipoprotein cholesterol level (CMO:0000052)	4	49178116	57114705	Rat
10450825	Scl78	Serum cholesterol level QTL 78	3.7	0.01	blood VLDL cholesterol amount (VT:0005144)	blood low density lipoprotein cholesterol level (CMO:0000053)	4	49178116	57114705	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat

Markers in Region

Wnt16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	50,830,981 - 50,831,209 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	49,379,305 - 49,379,532	NCBI	Rnor6.0
Rnor_5.0	4	49,170,178 - 49,170,405	UniSTS	Rnor5.0
RGSC_v3.4	4	48,619,919 - 48,620,146	UniSTS	RGSC3.4
Celera	4	46,037,424 - 46,037,651	UniSTS
Cytogenetic Map	4	q22	UniSTS

Wnt16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	50,831,026 - 50,831,209 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	49,379,350 - 49,379,532	NCBI	Rnor6.0
Rnor_5.0	4	49,170,223 - 49,170,405	UniSTS	Rnor5.0
RGSC_v3.4	4	48,619,964 - 48,620,146	UniSTS	RGSC3.4
Celera	4	46,037,469 - 46,037,651	UniSTS
Cytogenetic Map	4	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium							2	2			1		2
Low	2	6			11		6	7	62	14	24	1	6
Below cutoff	1	23	10	1	8	1		2	12	6	7	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006236143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000007822 ⟹ ENSRNOP00000007822

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	50,820,968 - 50,831,380 (+)	Ensembl
Rnor_6.0 Ensembl	4	49,369,296 - 49,379,703 (+)	Ensembl

RefSeq Acc Id:

NM_001109223 ⟹ NP_001102693

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	50,820,968 - 50,831,380 (+)	NCBI
Rnor_6.0	4	49,369,296 - 49,379,703 (+)	NCBI
Rnor_5.0	4	49,160,228 - 49,178,195 (+)	NCBI
RGSC_v3.4	4	48,609,677 - 48,620,317 (+)	RGD
Celera	4	46,027,411 - 46,037,822 (+)	RGD

Sequence:

show sequence

CATCAGCAGAAGTTTCTCACCTTGGAAAGCGAGGGACGCTCCCGCATCTCCAGCACGTACTCAC
CTCTGCGCGAGTGGACCTTAGGCTACTTTCTCCACCGCATCTTGCCTAGGGGACTGCCGATTGT
CTCTGTCCTTGCTGACCTTTTTAATGTTACCTTCCAGGGGAAAGAGGGCAAGGAACAACTGGGT
GCTAGGAAACTGACCCCAGGCCCTGCGGGCCTCTGGAGAGAGGAGACAGGAGAGGAGTGACTGG
GGCTGGGGGCCTCCATGCACGGGCCATGGACAGAGCGGCGCTCCTGGCCCTGCCCAGCTTGTGT
GCGCTGTGGGCAGCCGTGCTGTCGCTGCTCCCCTGCGGAACCCAGGGCAACTGGATGTGGTTGG
GCATCGCCTCCTTCGGGGTACCGGAGAAGCTGGGCTGCTCCGGCTTGCCGCTGAACAGCCGCCA
GAAGGAGCTGTGCAAGAGGAAACCGTACCTGCTGCCTAGCATCCGCGAGGGCGCCAGGCTGGGC
ATTCAGGAGTGCAGAAGCCAGTTCCGACACGAGAGGTGGAACTGTATGGTCGCCACTGCCACCT
CCACCCAGCTCGCTACAGCTCCCCTCTTTGGCTATGAACTGAGTAGCGGCACCAAGGAGACAGC
ATTCATTTATGCCATCATGGCTGCAGGCCTGGTGCACTCTGTAACCAGGTCATGCAGTGCAGGC
AACATGACCGAGTGTTCCTGTGACACCACCTTGCAGAACAGTGGCTCAGCGAGTGAAGGCTGGC
ACTGGGGTGGATGCTCTGATGATGTCCAGTACGGCATGTGGTTCAGCAGAAAGTTTCTAGACTT
ACCCGTCAGAAACACCACAGAAAAAGAAAGCAAAGTCCTGCTAGCCATGAATCTACACAACAAC
GAGGCAGGGCGGCAGGCTGTCGCCAAGTTAATGTCTGTGGACTGCCGCTGCCATGGTGTTTCCG
GCTCCTGTGCTGTGAAAACCTGCTGGAAAACTATGTCTTCTTTTGAAAAGATTGGGTATTTTTT
AAAGGATAAATATGAAAACAGCATCCAGATCTCAGACAAAACCAAGAGGAAGATGCGCAGGAGA
GAAAAAGACCAGAGGCAGACACCCATTCTCAAGGATGACTTGCTATACGTCCATAAGTCTCCCA
ACTACTGCGTGGAGAACAAGAAACTGGGTATTCCTGGGACCCAGGGCAGAGAGTGCAACCGTAC
GTCAGGAGGCGCGGATGGCTGTAACCTCCTCTGCTGTGGCCGAGGCTACAACACCCACGTAGTC
AGGCACGTGGAGAGGTGTGAGTGTAAGTTTATCTGGTGCTGTTACGTCCGCTGCAGGAGGTGTG
AAAGCATGACCGATGTCCACACTTGTAAGTAACCTCTCCATCCAGCCTAGCATGAGATTGCCTC
AGTAACAACCAGCTGTGTTGTCATCTGAAGGGCGCCCCCTACTGTGCACGGCGGGGAAGTCGCT
GCCTGTAAGAGTGTTCCCAGACCCCTGGGCCAGGCTGAGATTTCTTCTTTCTGGCAGACTTCAA
ATCCCAAGCTGCACGGCAGGATTGCTTGGGATTCTAAAGTTGAAAAGGTTGGCAGTCGCCTTTG
GATAGTTTGGGGAATATACGTTGGCATATAGGGAACAGCAATCTGTTTCCAAAGCAATATGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102693	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15149	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001102693 ⟸ NM_001109223
- Peptide Label:	precursor
- UniProtKB:	D4A3K6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MDRAALLALPSLCALWAAVLSLLPCGTQGNWMWLGIASFGVPEKLGCSGLPLNSRQKELCKRKP YLLPSIREGARLGIQECRSQFRHERWNCMVATATSTQLATAPLFGYELSSGTKETAFIYAIMAA GLVHSVTRSCSAGNMTECSCDTTLQNSGSASEGWHWGGCSDDVQYGMWFSRKFLDLPVRNTTEK ESKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGYFLKDKYENSI QISDKTKRKMRRREKDQRQTPILKDDLLYVHKSPNYCVENKKLGIPGTQGRECNRTSGGADGCN LLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK hide sequence

RefSeq Acc Id:

ENSRNOP00000007822 ⟸ ENSRNOT00000007822

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3K6-F1-model_v2	AlphaFold	D4A3K6	1-364	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692899

Promoter ID:

EPDNEW_R3424

Type:

single initiation site

Name:

Wnt16_1

Description:

Wnt family member 16

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	49,369,300 - 49,369,360	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562253	AgrOrtholog
BioCyc Gene	G2FUF-45506	BioCyc
Ensembl Genes	ENSRNOG00000005781	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000007822	ENTREZGENE
	ENSRNOP00000007822.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007822	ENTREZGENE
	ENSRNOT00000007822.5	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt16	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_CS	UniProtKB/TrEMBL
	Wnt_SF	UniProtKB/TrEMBL
KEGG Report	rno:500047	UniProtKB/TrEMBL
NCBI Gene	500047	ENTREZGENE
PANTHER	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt16	PhenoGen
PRINTS	WNT16PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
SMART	WNT1	UniProtKB/TrEMBL
UniProt	D4A3K6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt16	Wnt family member 16	Wnt16	wingless-type MMTV integration site family, member 16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt16	wingless-type MMTV integration site family, member 16	Wnt16	wingless-related MMTV integration site 16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Wnt16	wingless-related MMTV integration site 16			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)