Ucn3 (urocortin 3) - Rat Genome Database

Name: Ucn3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ucn3 (urocortin 3) Rattus norvegicus

Analyze

Symbol:

Ucn3

Name:

urocortin 3

RGD ID:

1562213

Description:

Predicted to enable corticotropin-releasing hormone receptor binding activity. Involved in several processes, including positive regulation of insulin secretion; positive regulation of membrane potential; and response to corticosterone. Located in axon terminus and varicosity. Orthologous to human UCN3 (urocortin 3); PARTICIPATES IN corticotropin-releasing hormone signaling pathway; INTERACTS WITH acrylamide; bisphenol A; vinclozolin.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC498791; RGD1562213; similar to urocortin III; urocortin 3 (stresscopin); urocortin-3

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UCN3 (urocortin 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ucn3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ucn3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UCN3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UCN3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UCN3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UCN3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ucn3 (urocortin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CSN2 (casein beta)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	UCN3 (urocortin 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ucn3 (urocortin 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ucn3l (urocortin 3, like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	66,309,952 - 66,315,571 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	66,309,371 - 66,315,990 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	69,783,706 - 69,790,010 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	17	73,612,535 - 73,618,839 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	17	67,655,540 - 67,661,838 (+)	NCBI	Rnor_WKY
Rnor_6.0	17	69,959,879 - 69,966,532 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	69,960,160 - 69,966,099 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	71,663,483 - 71,670,090 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	77,482,852 - 77,488,471 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	65,815,485 - 65,821,104 (+)	NCBI		Celera
Cytogenetic Map	17	q12.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

hypoparathyroidism-deafness-renal disease syndrome (ISO)

Inflammation (ISO)

lung disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

fonofos (ISO)

methotrexate (ISO)

parathion (ISO)

pirinixic acid (ISO)

terbufos (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,ISO)

cellular response to hypoxia (IEP)

cellular response to nutrient levels (IBA,IEP)

digestion (IEA)

hormone-mediated signaling pathway (IBA,ISO)

positive regulation of insulin secretion (IMP)

positive regulation of membrane potential (IDA)

response to corticosterone (IEP)

response to glucose (IEP)

response to immobilization stress (IEP)

response to starvation (IEP)

Cellular Component

axon (IDA)

axon terminus (IDA)

extracellular space (IBA)

varicosity (IDA)

Molecular Function

corticotropin-releasing hormone receptor 2 binding (IEA)

corticotropin-releasing hormone receptor binding (IBA,ISO)

hormone activity (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

corticotropin-releasing hormone signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Protective effects of the urocortin homologues stresscopin (SCP) and stresscopin-related peptide (SRP) against hypoxia/reoxygenation injury in rat neonatal cardiomyocytes.	Chanalaris A, etal., J Mol Cell Cardiol. 2003 Oct;35(10):1295-305.
2.	Identification of urocortin 3 afferent projection to the ventromedial nucleus of the hypothalamus in rat brain.	Chen P, etal., J Comp Neurol. 2011 Jul 1;519(10):2023-42. doi: 10.1002/cne.22620.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	The molecular mechanisms underlying the regulation of the biological activity of corticotropin-releasing hormone receptors: implications for physiology and pathophysiology.	Hillhouse EW and Grammatopoulos DK, Endocr Rev. 2006 May;27(3):260-86. Epub 2006 Feb 16.
5.	Urocortin 3 modulates the neuroendocrine stress response and is regulated in rat amygdala and hypothalamus by stress and glucocorticoids.	Jamieson PM, etal., Endocrinology. 2006 Oct;147(10):4578-88. Epub 2006 Jun 29.
6.	Urocortin III-immunoreactive projections in rat brain: partial overlap with sites of type 2 corticotrophin-releasing factor receptor expression.	Li C, etal., J Neurosci 2002 Feb 1;22(3):991-1001.
7.	Urocortin 3 regulates glucose-stimulated insulin secretion and energy homeostasis.	Li C, etal., Proc Natl Acad Sci U S A. 2007 Mar 6;104(10):4206-11. Epub 2007 Feb 27.
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Chronic peripheral administration of corticotropin-releasing factor causes colonic barrier dysfunction similar to psychological stress.	Teitelbaum AA, etal., Am J Physiol Gastrointest Liver Physiol. 2008 Sep;295(3):G452-9. Epub 2008 Jul 17.

Additional References at PubMed

PMID:11329063	PMID:11416224	PMID:17019404	PMID:17218420	PMID:19395554	PMID:19952342	PMID:22227020	PMID:22651925	PMID:22774996	PMID:24462512	PMID:25122003	PMID:25779038
PMID:31415798	PMID:35325259

Genomics

Comparative Map Data

Ucn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	66,309,952 - 66,315,571 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	66,309,371 - 66,315,990 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	69,783,706 - 69,790,010 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	17	73,612,535 - 73,618,839 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	17	67,655,540 - 67,661,838 (+)	NCBI	Rnor_WKY
Rnor_6.0	17	69,959,879 - 69,966,532 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	69,960,160 - 69,966,099 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	71,663,483 - 71,670,090 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	77,482,852 - 77,488,471 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	65,815,485 - 65,821,104 (+)	NCBI		Celera
Cytogenetic Map	17	q12.2	NCBI

UCN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	5,364,966 - 5,374,692 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	10	5,364,966 - 5,374,692 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	5,406,929 - 5,416,655 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	5,396,976 - 5,406,169 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	5,396,975 - 5,406,169	NCBI
Celera	10	5,339,562 - 5,339,918 (+)	NCBI		Celera
Cytogenetic Map	10	p15.1	NCBI
HuRef	10	5,338,811 - 5,339,167 (+)	NCBI		HuRef
CHM1_1	10	5,406,973 - 5,416,168 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	5,366,734 - 5,377,963 (+)	NCBI		T2T-CHM13v2.0

Ucn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	3,990,688 - 3,995,349 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	3,990,688 - 3,995,349 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	3,940,688 - 3,945,349 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	3,940,688 - 3,945,349 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	3,939,934 - 3,944,595 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	3,940,402 - 3,940,896 (-)	NCBI		MGSCv36	mm8
Celera	13	3,927,567 - 3,932,226 (-)	NCBI		Celera
Cytogenetic Map	13	A1	NCBI

Ucn3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955463	218,456 - 218,959 (+)	NCBI	ChiLan1.0	ChiLan1.0

UCN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	10	17,935,959 - 17,936,444 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	5,410,501 - 5,419,650 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	5,398,032 - 5,406,168 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	5,405,683 - 5,406,168 (+)	Ensembl	panpan1.1		panPan2

UCN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	30,541,316 - 30,547,839 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	30,541,779 - 30,542,282 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	27,570,906 - 27,577,392 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	30,921,836 - 30,928,322 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	30,922,266 - 30,922,769 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	28,017,884 - 28,024,383 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	28,855,014 - 28,861,522 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	29,572,632 - 29,579,118 (-)	NCBI		UU_Cfam_GSD_1.0

UCN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	10	65,491,231 - 65,495,879 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	71,585,818 - 71,590,322 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UCN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	5,491,134 - 5,500,663 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	5,498,945 - 5,499,430 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	10,742,618 - 10,751,305 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ucn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624796	130,924 - 131,886 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ucn3
51 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	46
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000023887
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat
7411575	Bw140	Body weight QTL 140	30.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
8694181	Bw151	Body weight QTL 151	4.36	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	48560935	86533673	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	49920154	86533673	Rat
2303580	Gluco49	Glucose level QTL 49	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	50040271	86533673	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	50909099	86022412	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	53498828	82479847	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	57246723	70156904	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	57246723	70852846	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	57246843	82046127	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	59005649	77910000	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	60781426	86533673	Rat
7411577	Bw141	Body weight QTL 141		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	17	62619516	86533673	Rat
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63640009	73951021	Rat
631502	Cm26	Cardiac mass QTL 26	3.71		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	65703580	81153923	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	nervous system	renal system	reproductive system	respiratory system
High
Medium							6		1
Low	1					25	10	10
Below cutoff		2	2	2	2	25	2	12	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001080208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF078967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000294	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000023887 ⟹ ENSRNOP00000023887

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	66,309,371 - 66,315,990 (+)	Ensembl
Rnor_6.0 Ensembl	17	69,960,160 - 69,966,099 (+)	Ensembl

RefSeq Acc Id:

NM_001080208 ⟹ NP_001073677

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	66,309,952 - 66,315,571 (+)	NCBI
Rnor_6.0	17	69,960,160 - 69,966,111 (+)	NCBI
Rnor_5.0	17	71,663,483 - 71,670,090 (+)	NCBI
RGSC_v3.4	17	77,482,852 - 77,488,471 (+)	RGD
Celera	17	65,815,485 - 65,821,104 (+)	RGD

Sequence:

show sequence

CTAGAGCAAAGTCCTCTTACAGGGAGCGATGCTGATGCCCACTTACTTCCTGCTGCTTCTGCTG
CTGCTCCTAGGGGGCCCAAGGACAAGCCTCTCCCACAAGTTCTACAACGCAGGACCAGTCTTCA
GCTGCCTCAACACAGCCCTGTCTGAGGTCAAGAAGAACAAGCTGGAGGATGTGCCGGTGCTGAG
CAAGAAGAACTTTGGCTACCTGCCCACACAAGACCCTTCGGGAGAAGAAGAGGATGAACAAAAA
CACATCAAGAACAAAAGAACTTTCTCAGACGCTGTGGGTGGGAATGGAGGTAGAAGCATCCGGT
ACAGATACCAATCCCAAGCACAGCCCAAAGGAAAGCTGTACCCGGACAAGGTCAAAAACGACCG
GGGCACCAAGTTCACTCTGTCCCTCGACGTTCCCACTAACATCATGAACATCCTCTTCAACATT
GACAAGGCCAAGAATTTGCGAGCCAAGGCAGCGGCCAATGCTCAACTCATGGCACAGATTGGGA
AAAAGAAATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001073677	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABM45865	(Get FASTA)	NCBI Sequence Viewer
	EDL78577	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001073677 ⟸ NM_001080208
- Peptide Label:	precursor
- UniProtKB:	A1YKY5 (UniProtKB/TrEMBL), F7FC99 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLMPTYFLLLLLLLLGGPRTSLSHKFYNAGPVFSCLNTALSEVKKNKLEDVPVLSKKNFGYLPT QDPSGEEEDEQKHIKNKRTFSDAVGGNGGRSIRYRYQSQAQPKGKLYPDKVKNDRGTKFTLSLD VPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK hide sequence

RefSeq Acc Id:

ENSRNOP00000023887 ⟸ ENSRNOT00000023887

Protein Domains

Corticotropin-releasing factor

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7FC99-F1-model_v2	AlphaFold	F7FC99	1-161	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562213	AgrOrtholog
BioCyc Gene	G2FUF-8825	BioCyc
Ensembl Genes	ENSRNOG00000017759	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000023887	ENTREZGENE
	ENSRNOP00000023887.5	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023887	ENTREZGENE
	ENSRNOT00000023887.6	UniProtKB/TrEMBL
InterPro	CRF	UniProtKB/TrEMBL
	Urocortin_II/III	UniProtKB/TrEMBL
KEGG Report	rno:498791	UniProtKB/TrEMBL
NCBI Gene	498791	ENTREZGENE
PANTHER	PTHR17575	UniProtKB/TrEMBL
	UROCORTIN-3	UniProtKB/TrEMBL
Pfam	CRF	UniProtKB/TrEMBL
PhenoGen	Ucn3	PhenoGen
UniProt	A1YKY5	ENTREZGENE, UniProtKB/TrEMBL
	F7FC99	ENTREZGENE
UniProt Secondary	F7FC99	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-24	Ucn3	urocortin 3	Ucn3	urocortin 3 (stresscopin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-08-29	Ucn3	urocortin 3 (stresscopin)	Ucn3	urocortin 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Ucn3	urocortin 3	RGD1562213_predicted	similar to urocortin III (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562213_predicted	similar to urocortin III (predicted)	LOC498791	similar to urocortin III	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498791	similar to urocortin III			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations