Edar (ectodysplasin-A receptor) - Rat Genome Database

Name: Edar
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Edar (ectodysplasin-A receptor) Rattus norvegicus

Analyze

Symbol:

Edar

Name:

ectodysplasin-A receptor

RGD ID:

1561714

Description:

Predicted to enable transmembrane signaling receptor activity. Predicted to be involved in positive regulation of JNK cascade and positive regulation of canonical NF-kappaB signal transduction. Predicted to act upstream of or within several processes, including hair follicle development; positive regulation of non-canonical NF-kappaB signal transduction; and salivary gland cavitation. Predicted to be located in apical part of cell. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in ectodermal dysplasia 10A and ectodermal dysplasia 10B. Orthologous to human EDAR (ectodysplasin A receptor); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC365581; RGD1561714; similar to Ectodysplasin-A receptor; similar to Tumor necrosis factor receptor superfamily member EDAR precursor (Anhidrotic ectodysplasin receptor 1) (Ectodysplasin-A receptor) (Ectodermal dysplasia receptor) (Downless); tumor necrosis factor receptor superfamily member EDAR

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EDAR (ectodysplasin A receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Edar (ectodysplasin-A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Edar (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EDAR (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EDAR (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Edar (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EDAR (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EDAR (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Edar (ectodysplasin A receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	EDAR (ectodysplasin A receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Edar (ectodysplasin-A receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	edar (ectodysplasin A receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	edar	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	26,587,836 - 26,666,543 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	26,587,839 - 26,666,494 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	27,595,453 - 27,623,881 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	26,981,678 - 27,010,102 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	27,726,632 - 27,755,014 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	28,179,132 - 28,263,092 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	28,179,140 - 28,263,037 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	29,996,972 - 30,079,875 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	37,135,534 - 37,164,197 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	28,038,358 - 28,066,702 (-)	NCBI		Celera
Cytogenetic Map	20	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alpers-Huttenlocher syndrome (ISO)

anodontia (ISO)

distal hereditary motor neuronopathy type 7A (ISO)

ectodermal dysplasia (ISO)

ectodermal dysplasia 10A (ISO)

ectodermal dysplasia 10B (ISO)

ectodermal dysplasia 11B (ISO)

ENCEPHALOPATHY, ACUTE, INFECTION-INDUCED, SUSCEPTIBILITY TO, 3 (ISO)

genetic disease (ISO)

hypohidrotic ectodermal dysplasia (ISO,ISS)

otitis media (ISO)

tooth agenesis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1-naphthyl isothiocyanate (EXP)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

amitrole (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

CGP 52608 (ISO)

diethyl malate (ISO)

epoxiconazole (ISO)

fulvestrant (ISO)

methapyrilene (ISO)

methimazole (EXP)

nickel atom (ISO)

paracetamol (EXP)

quercetin (ISO)

silicon dioxide (ISO)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

triptonide (ISO)

troglitazone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cytokine-mediated signaling pathway (ISO)

hair follicle development (ISO)

odontogenesis of dentin-containing tooth (ISO)

pigmentation (ISO)

positive regulation of canonical NF-kappaB signal transduction (IBA,ISO)

positive regulation of gene expression (ISO)

positive regulation of JNK cascade (IBA)

positive regulation of non-canonical NF-kappaB signal transduction (ISO)

salivary gland cavitation (ISO)

Cellular Component

apical part of cell (ISO)

plasma membrane (IBA,ISO)

Molecular Function

protein binding (ISO)

signaling receptor activity (IBA,ISO)

transmembrane signaling receptor activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Role of ectodysplasin signalling in middle ear and nasal pathology in rat and mouse models of hypohidrotic ectodermal dysplasia.	Del-Pozo J, etal., Dis Model Mech. 2019 Apr 25;12(4). pii: 12/4/dmm037804. doi: 10.1242/dmm.037804.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Mutations in the human homologue of mouse dl cause autosomal recessive and dominant hypohidrotic ectodermal dysplasia.	Monreal AW, etal., Nat Genet. 1999 Aug;22(4):366-9.
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:544312	PMID:11039935	PMID:12629675	PMID:18508042

Genomics

Comparative Map Data

Edar
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	26,587,836 - 26,666,543 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	26,587,839 - 26,666,494 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	27,595,453 - 27,623,881 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	26,981,678 - 27,010,102 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	27,726,632 - 27,755,014 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	28,179,132 - 28,263,092 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	28,179,140 - 28,263,037 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	29,996,972 - 30,079,875 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	37,135,534 - 37,164,197 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	20	28,038,358 - 28,066,702 (-)	NCBI		Celera
Cytogenetic Map	20	q11	NCBI

EDAR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	108,894,471 - 108,989,220 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	108,894,471 - 108,989,372 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	109,510,927 - 109,605,676 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	108,877,361 - 108,972,260 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	108,969,448 - 109,064,346	NCBI
Celera	2	103,820,860 - 103,915,790 (-)	NCBI		Celera
Cytogenetic Map	2	q13	NCBI
HuRef	2	103,109,351 - 103,204,259 (-)	NCBI		HuRef
CHM1_1	2	109,515,194 - 109,610,098 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	109,355,029 - 109,449,802 (-)	NCBI		T2T-CHM13v2.0

Edar
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	58,436,602 - 58,511,518 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	58,436,611 - 58,511,476 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	58,600,780 - 58,675,696 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	58,600,789 - 58,675,654 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	58,063,536 - 58,138,444 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	58,582,058 - 58,656,978 (-)	NCBI		MGSCv36	mm8
MGSCv36	10	57,996,146 - 58,071,053 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	10	B4	NCBI
cM Map	10	29.37	NCBI

Edar
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955470	12,309,048 - 12,362,570 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955470	12,310,680 - 12,362,555 (-)	NCBI	ChiLan1.0	ChiLan1.0

EDAR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	21,008,536 - 21,062,814 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	95,132,396 - 95,172,218 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	110,146,499 - 110,241,556 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	110,146,499 - 110,234,398 (-)	Ensembl	panpan1.1		panPan2

EDAR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	34,873,311 - 34,943,140 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	34,848,526 - 34,940,784 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	34,772,071 - 34,866,543 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	35,700,824 - 35,795,378 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	35,700,812 - 35,795,448 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	35,430,446 - 35,524,880 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	35,712,643 - 35,807,092 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	35,901,219 - 35,995,761 (+)	NCBI		UU_Cfam_GSD_1.0

Edar
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	91,938,934 - 91,970,049 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936829	429,561 - 458,943 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936829	429,667 - 458,943 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EDAR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	47,396,330 - 47,465,784 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	47,396,303 - 47,466,234 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	49,558,908 - 49,626,194 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EDAR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	12,430,405 - 12,527,160 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	12,433,418 - 12,468,841 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	7,173,441 - 7,274,919 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Edar
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	11,983,550 - 11,998,918 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624749	11,981,782 - 11,998,933 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Edar
404 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	801
Count of miRNA genes:	313
Interacting mature miRNAs:	400
Transcripts:	ENSRNOT00000030348
Prediction methods:	Microtar, Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	17617832	47606836	Rat
2317880	Alcrsp25	Alcohol response QTL 25	2.3		response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	17697550	54435887	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	19190721	54435887	Rat
2303578	Gluco50	Glucose level QTL 50	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	20	25106722	54435887	Rat
2303587	Bw93	Body weight QTL 93	13		body mass (VT:0001259)	body weight (CMO:0000012)	20	25106722	54435887	Rat
2300188	Bmd68	Bone mineral density QTL 68	6.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	20	25106722	54435887	Rat
1331747	Hrtrt16	Heart rate QTL 16	3.163		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	20	25209734	54435887	Rat

Markers in Region

D20Rat36

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	26,621,485 - 26,621,635 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	28,218,193 - 28,218,342	NCBI	Rnor6.0
Rnor_5.0	20	30,035,898 - 30,036,047	UniSTS	Rnor5.0
RGSC_v3.4	20	37,132,181 - 37,132,331	RGD	RGSC3.4
RGSC_v3.4	20	37,132,182 - 37,132,331	UniSTS	RGSC3.4
RGSC_v3.1	20	37,145,981 - 37,146,131	RGD
Celera	20	28,069,905 - 28,070,055	UniSTS
SHRSP x BN Map	20	21.46	UniSTS
SHRSP x BN Map	20	21.46	RGD
FHH x ACI Map	20	12.4099	RGD
Cytogenetic Map	20	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			1	1		1
Low	3		30	20	19	20	7	10	60	24	21	2	7
Below cutoff		9	10	6		6	1	1	14	11	16	9	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	FQ211923	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000030348 ⟹ ENSRNOP00000029258

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	26,587,839 - 26,666,494 (-)	Ensembl
Rnor_6.0 Ensembl	20	28,179,140 - 28,263,037 (-)	Ensembl

RefSeq Acc Id:

NM_001191899 ⟹ NP_001178828

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	26,587,836 - 26,666,543 (-)	NCBI
Rnor_6.0	20	28,181,194 - 28,214,990 (-)	NCBI
Rnor_5.0	20	29,996,972 - 30,079,875 (-)	NCBI
Celera	20	28,038,358 - 28,066,702 (-)	NCBI

Sequence:

show sequence

ATGGCCCACGTCGGGGACTGCAAGTGGATGTCCTGGCTCCCAGTGCTGGTGGTGTCTCTGATGT
GCTCAGCCAAGGCAGAGGACTCCAACTGTGGCGAGAATGAATACCACAACCAAACTACCGGGCT
GTGCCAGCAGTGTCCTCCATGCAGACCAGGGGAGGAGCCCTACATGTCCTGTGGTTACGGCACC
AAAGATGAGGACTATGGCTGCGTGCCCTGCCCTGCAGAGAAGTTCTCCAAAGGAGGTTATCAGA
TATGCAGGCGCCACAAGGACTGTGAGGGCTTCTTCCGGGCCACCGTACTGACACCAGGAGACAT
GGAAAATGATGCTGAGTGTGGCCCGTGTCTGCCTGGCTACTACATGCTGGAAAACAGACCCAGG
AACATCTACGGCATGGTCTGCTACTCCTGCCTCTTGGCACCTCCCAACACCAAGGAATGTGTGG
GAGCCACTTCCGGGGTTTCAGCTCACTCCTCCAGCACTTCAGGCGGCAGCACCTTGTCCCCCTT
CCAGCATGCTCACAAAGAGCTCTCAAGTCAAGGACACCTGGCCACCGCCCTGATTATTGCCATG
TCTACAATCTTCATCATGGCCATAGCCATTGTCCTCATCATCATGTTCTATATCATGAAGACTA
AGCCTTCAGCTCCAGCCTGCTGTAGCAGTCCCCCAGGAAAAAGTGCAGAAGCCCCAGCTAACAC
ACATGAGGAGAAAAAAGAGGCCCCAGACAGTGTGGTGACTTTCCCTGAGAATGGTGAATTCCAG
AAGTTGACAGCAACACCCACAAAGACCCCAAAAAGTGAGAACGATGCCTCCTCTGAGAATGAGC
AGCTGCTGAGTCGCAGTGTGGACAGTGATGAAGAGCCAGCCCCGGACAAGCAGGGGTCCCCAGA
GCTATGCCTGCTGTCGCTAGTTCATCTGGCCAGGGAGAAGTCTGTAGCCAGTAACAAGTCTGCT
GGGATCCAAAGCCGAAGGAAAAAGATATTGGATGTGTATGCGAACGTGTGTGGTGTTGTTGAAG
GTCTCAGCCCCACGGAGCTGCCTTTTGATTGCCTTGAAAAGACAAGCAGAATGCTCAGTTCTAC
CTACAACTCTGAGAAAGCAGTCGTGAAAACGTGGCGCCACCTTGCTGAGAGCTTTGGACTGAAG
AGGGATGAGATTGGGGGCATGACTGATGGCATGCAGCTCTTTGACCGCATCAGCACTGCGGGCT
ACAGCATCCCAGAGCTGCTCACGAAGCTGGTACAGATCGAGAGGCTGGATGCTGTGGAGTCCTT
GTGTGCAGACATATTGGAGTGGGCTGGGGTTGTACCCCCTGCCTCCCCACCCCCAGCTGCATCC
TGA

hide sequence

RefSeq Acc Id:

XM_039098901 ⟹ XP_038954829

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	26,587,836 - 26,666,543 (-)	NCBI

RefSeq Acc Id:

XM_039098902 ⟹ XP_038954830

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	26,587,836 - 26,666,543 (-)	NCBI

RefSeq Acc Id:

XM_039098903 ⟹ XP_038954831

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	26,587,836 - 26,666,543 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178828	(Get FASTA)	NCBI Sequence Viewer
	XP_038954829	(Get FASTA)	NCBI Sequence Viewer
	XP_038954830	(Get FASTA)	NCBI Sequence Viewer
	XP_038954831	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029258
	ENSRNOP00000029258.5

RefSeq Acc Id:	NP_001178828 ⟸ NM_001191899
- Peptide Label:	precursor
- UniProtKB:	D3ZGP2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAHVGDCKWMSWLPVLVVSLMCSAKAEDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGT KDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPR NIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSSQGHLATALIIAM STIFIMAIAIVLIIMFYIMKTKPSAPACCSSPPGKSAEAPANTHEEKKEAPDSVVTFPENGEFQ KLTATPTKTPKSENDASSENEQLLSRSVDSDEEPAPDKQGSPELCLLSLVHLAREKSVASNKSA GIQSRRKKILDVYANVCGVVEGLSPTELPFDCLEKTSRMLSSTYNSEKAVVKTWRHLAESFGLK RDEIGGMTDGMQLFDRISTAGYSIPELLTKLVQIERLDAVESLCADILEWAGVVPPASPPPAAS hide sequence

RefSeq Acc Id:

ENSRNOP00000029258 ⟸ ENSRNOT00000030348

RefSeq Acc Id:	XP_038954831 ⟸ XM_039098903
- Peptide Label:	isoform X3
- UniProtKB:	D3ZGP2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038954830 ⟸ XM_039098902
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038954829 ⟸ XM_039098901
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZGP2-F1-model_v2	AlphaFold	D3ZGP2	1-448	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701583

Promoter ID:

EPDNEW_R12107

Type:

initiation region

Name:

Edar_1

Description:

ectodysplasin-A receptor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	28,263,067 - 28,263,127	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561714	AgrOrtholog
BioCyc Gene	G2FUF-3783	BioCyc
Ensembl Genes	ENSRNOG00000028598	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030348	ENTREZGENE
	ENSRNOT00000030348.7	UniProtKB/TrEMBL
Gene3D-CATH	1.10.533.10	UniProtKB/TrEMBL
	Tumor Necrosis Factor Receptor, subunit A, domain 2	UniProtKB/TrEMBL
InterPro	DEATH-like	UniProtKB/TrEMBL
	EDAR_N	UniProtKB/TrEMBL
	TNR19/27/EDAR	UniProtKB/TrEMBL
KEGG Report	rno:365581	UniProtKB/TrEMBL
NCBI Gene	365581	ENTREZGENE
PANTHER	TNFR-CYS DOMAIN-CONTAINING PROTEIN	UniProtKB/TrEMBL
	TUMOR NECROSIS FACTOR RECEPTOR SUPERFAMILY MEMBER EDAR	UniProtKB/TrEMBL
PhenoGen	Edar	PhenoGen
RatGTEx	ENSRNOG00000028598	RatGTEx
Superfamily-SCOP	DEATH_like	UniProtKB/TrEMBL
UniProt	D3ZGP2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Edar	ectodysplasin-A receptor	LOC678867	similar to Tumor necrosis factor receptor superfamily member EDAR precursor (Anhidrotic ectodysplasin receptor 1) (Ectodysplasin-A receptor) (Ectodermal dysplasia receptor) (Downless)	Data merged from RGD:1595551	1643240	APPROVED
2008-02-29	Edar	ectodysplasin-A receptor	RGD1561714_predicted	similar to Ectodysplasin-A receptor (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC678867	similar to Tumor necrosis factor receptor superfamily member EDAR precursor (Anhidrotic ectodysplasin receptor 1) (Ectodysplasin-A receptor) (Ectodermal dysplasia receptor) (Downless)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1561714_predicted	similar to Ectodysplasin-A receptor (predicted)	LOC365581	similar to Ectodysplasin-A receptor	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC365581	similar to Ectodysplasin-A receptor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)