E2f3 (E2F transcription factor 3)

Advanced Search (OLGA)

Gene: E2f3 (E2F transcription factor 3) Rattus norvegicus

Analyze

Symbol:

E2f3

Name:

E2F transcription factor 3

RGD ID:

1561600

Description:

Predicted to enable DNA-binding transcription activator activity; DNA-binding transcription factor activity, RNA polymerase II-specific; and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to contribute to DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including G1/S transition of mitotic cell cycle; positive regulation of vascular associated smooth muscle cell apoptotic process; and protein import into nucleus. Predicted to act upstream of or within positive regulation of DNA-templated transcription and positive regulation of cell population proliferation. Predicted to be located in nucleus. Predicted to be part of RNA polymerase II transcription regulator complex. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma and prostate cancer. Orthologous to human E2F3 (E2F transcription factor 3); PARTICIPATES IN cell cycle pathway, mitotic; ceramide signaling pathway; chronic myeloid leukemia pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-acetamidofluorene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E2F transcription factor 3-like; LOC100361421; LOC291105; RGD1561600; similar to E2f3 protein; similar to Transcription factor E2F3 (E2F-3); transcription factor E2F3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	E2F3 (E2F transcription factor 3)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	E2f3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	E2f3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	E2F3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	E2F3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	E2f3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	E2F3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	E2F3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	E2f3 (E2F transcription factor 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RPS27A (ribosomal protein S27a)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	E2F3 (E2F transcription factor 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	E2f3 (E2F transcription factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	e2f3 (E2F transcription factor 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	E2f1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	e2f3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	34,810,355 - 34,887,725 (+)	NCBI		GRCr8
mRatBN7.2	17	34,601,756 - 34,679,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	34,601,830 - 34,676,253 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	34,421,885 - 34,499,059 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	36,025,759 - 36,102,934 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	34,417,688 - 34,494,867 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	36,334,136 - 36,408,831 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	36,334,147 - 36,408,831 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	37,641,855 - 37,716,592 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	41,079,346 - 41,145,568 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	34,130,042 - 34,203,210 (+)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

high grade glioma (ISO)

lung adenocarcinoma (ISO)

lung non-small cell carcinoma (ISO)

lung squamous cell carcinoma (ISO)

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

(S)-naringenin (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-acetamidofluorene (EXP)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-nitroquinoline N-oxide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

alpha-pinene (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylparaben (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclophosphamide (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

eugenol (ISO)

formaldehyde (ISO)

furan (EXP)

geldanamycin (ISO)

gentamycin (EXP)

glyphosate (ISO)

GW 3965 (ISO)

hexane (EXP)

indometacin (ISO)

inulin (ISO)

kojic acid (ISO)

Lasiocarpine (ISO)

leptomycin B (ISO)

lidocaine (EXP,ISO)

lipopolysaccharide (ISO)

menadione (ISO)

methimazole (EXP)

methotrexate (ISO)

methoxychlor (EXP)

methylparaben (ISO)

monosodium L-glutamate (ISO)

motexafin gadolinium (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

nickel atom (ISO)

nicotine (ISO)

ochratoxin A (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propylparaben (ISO)

quercetin (ISO)

reactive oxygen species (ISO)

resveratrol (ISO)

retinyl acetate (ISO)

ritonavir (ISO)

silver(1+) nitrate (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

Triptolide (EXP)

valproic acid (ISO)

zinc acetate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G1/S transition of mitotic cell cycle (ISO)

negative regulation of fat cell proliferation (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of vascular associated smooth muscle cell apoptotic process (ISO)

protein import into nucleus (ISO)

regulation of DNA-templated transcription (ISO)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

nucleus (ISO)

RNA polymerase II transcription regulator complex (IBA,ISO)

Molecular Function

cis-regulatory region sequence-specific DNA binding (ISO)

DNA binding (ISO)

DNA-binding transcription activator activity (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

ceramide signaling pathway (IEA)

chronic myeloid leukemia pathway (IEA)

glioma pathway (IEA)

melanoma pathway (IEA)

non-small cell lung carcinoma pathway (IEA)

pancreatic cancer pathway (IEA)

prostate cancer pathway (IEA)

small cell lung carcinoma pathway (IEA)

urinary bladder cancer pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Nuclear overexpression of the E2F3 transcription factor in human lung cancer.	Cooper CS, etal., Lung Cancer. 2006 Nov;54(2):155-62. doi: 10.1016/j.lungcan.2006.07.005. Epub 2006 Aug 30.
2.	Transcription factor E2F3 overexpressed in prostate cancer independently predicts clinical outcome.	Foster CS, etal., Oncogene. 2004 Aug 5;23(35):5871-9. doi: 10.1038/sj.onc.1207800.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Measurement of blood E2F3 mRNA in prostate cancer by quantitative RT-PCR: a preliminary study.	Pipinikas CP, etal., Biomarkers. 2007 Sep-Oct;12(5):541-57. doi: 10.1080/13547500701391353 .
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Knockdown of E2F3 Inhibits Proliferation, Migration, and Invasion and Increases Apoptosis in Glioma Cells.	Shen ZG, etal., Oncol Res. 2017 Nov 2;25(9):1555-1566. doi: 10.3727/096504017X14897158009178. Epub 2017 Mar 23.
8.	Autoregulatory feedback loop of EZH2/miR-200c/E2F3 as a driving force for prostate cancer development.	Tao T, etal., Biochim Biophys Acta. 2014 Sep;1839(9):858-65. doi: 10.1016/j.bbagrm.2014.07.001. Epub 2014 Jul 10.
9.	Genetic variants of genes in the Notch signaling pathway predict overall survival of non-small cell lung cancer patients in the PLCO study.	Xu Y, etal., Oncotarget. 2016 Sep 20;7(38):61716-61727. doi: 10.18632/oncotarget.11436.

Additional References at PubMed

PMID:7739537	PMID:11980909	PMID:12893818	PMID:15158336	PMID:15574595	PMID:15722552	PMID:15735762	PMID:17062573	PMID:17102628	PMID:18541936	PMID:20176812	PMID:22886504
PMID:23332764	PMID:33058540	PMID:34666672	PMID:35616132

Genomics

Comparative Map Data

E2f3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	34,810,355 - 34,887,725 (+)	NCBI		GRCr8
mRatBN7.2	17	34,601,756 - 34,679,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	34,601,830 - 34,676,253 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	34,421,885 - 34,499,059 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	36,025,759 - 36,102,934 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	34,417,688 - 34,494,867 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	36,334,136 - 36,408,831 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	36,334,147 - 36,408,831 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	37,641,855 - 37,716,592 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	41,079,346 - 41,145,568 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	34,130,042 - 34,203,210 (+)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

E2F3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	20,401,879 - 20,493,714 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	20,401,879 - 20,493,714 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	20,402,110 - 20,493,945 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	20,510,377 - 20,601,921 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	20,510,376 - 20,601,921	NCBI
Celera	6	21,635,267 - 21,727,062 (+)	NCBI		Celera
Cytogenetic Map	6	p22.3	NCBI
HuRef	6	20,346,529 - 20,438,219 (+)	NCBI		HuRef
CHM1_1	6	20,404,479 - 20,496,262 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	20,273,917 - 20,365,731 (+)	NCBI		T2T-CHM13v2.0

E2f3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	30,090,558 - 30,171,172 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	30,090,558 - 30,170,046 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	29,906,575 - 29,986,064 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	29,906,575 - 29,986,063 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	29,998,444 - 30,077,932 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	29,917,237 - 29,993,528 (-)	NCBI		MGSCv36	mm8
Celera	13	30,125,315 - 30,204,809 (-)	NCBI		Celera
Cytogenetic Map	13	A3.2	NCBI
cM Map	13	13.09	NCBI

E2f3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955483	6,042,863 - 6,117,479 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955483	6,039,569 - 6,116,000 (-)	NCBI	ChiLan1.0	ChiLan1.0

E2F3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	35,036,930 - 35,128,398 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	31,036,391 - 31,127,855 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	20,225,471 - 20,317,199 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	20,574,244 - 20,665,785 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	20,574,898 - 20,665,785 (+)	Ensembl	panpan1.1		panPan2

E2F3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	19,012,646 - 19,086,674 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	19,012,324 - 19,083,634 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	18,971,644 - 19,045,676 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	19,123,558 - 19,197,676 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	19,122,042 - 19,194,624 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	18,931,701 - 19,005,696 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	18,996,668 - 19,070,695 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	20,416,008 - 20,490,009 (+)	NCBI		UU_Cfam_GSD_1.0

E2f3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	5,947,295 - 6,019,002 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936552	5,711,923 - 5,783,694 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936552	5,712,247 - 5,783,643 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

E2F3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	15,794,178 - 15,870,204 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	15,793,519 - 15,870,213 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	16,704,641 - 16,779,074 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

E2F3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	51,714,052 - 51,805,827 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666044	20,694,985 - 20,787,283 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

E2f3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	6,185,366 - 6,266,000 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	6,182,087 - 6,266,097 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in E2f3
412 total Variants

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mir34a	rno-miR-34a-5p	Mirtarbase	external_info	Western blot	Functional MTI	18942116

Predicted Target Of

	Summary Value
Count of predictions:	516
Count of miRNA genes:	247
Interacting mature miRNAs:	286
Transcripts:	ENSRNOT00000050261
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27027949	36146731	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat

Markers in Region

PMC85656P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	34,601,707 - 34,601,817 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	36,334,025 - 36,334,134	NCBI	Rnor6.0
Rnor_5.0	17	37,641,744 - 37,641,853	UniSTS	Rnor5.0
RGSC_v3.4	17	41,079,235 - 41,079,344	UniSTS	RGSC3.4
Celera	17	34,129,931 - 34,130,040	UniSTS
Cytogenetic Map	17	p12	UniSTS

PMC85656P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	34,601,100 - 34,601,275 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	36,333,418 - 36,333,592	NCBI	Rnor6.0
Rnor_5.0	17	37,641,137 - 37,641,311	UniSTS	Rnor5.0
RGSC_v3.4	17	41,078,628 - 41,078,802	UniSTS	RGSC3.4
Celera	17	34,129,324 - 34,129,498	UniSTS
Cytogenetic Map	17	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001137626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039095507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050261 ⟹ ENSRNOP00000040345

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	34,601,830 - 34,676,253 (+)	Ensembl
Rnor_6.0 Ensembl	17	36,334,147 - 36,408,831 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081368 ⟹ ENSRNOP00000071597

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	34,601,830 - 34,676,253 (+)	Ensembl
Rnor_6.0 Ensembl	17	36,334,589 - 36,408,486 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000091334 ⟹ ENSRNOP00000068682

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	34,603,273 - 34,675,825 (+)	Ensembl
Rnor_6.0 Ensembl	17	36,335,804 - 36,408,401 (+)	Ensembl

RefSeq Acc Id:

NM_001137626 ⟹ NP_001131098

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,810,416 - 34,887,725 (+)	NCBI
mRatBN7.2	17	34,601,819 - 34,679,139 (+)	NCBI
Rnor_6.0	17	36,334,136 - 36,408,831 (+)	NCBI
Rnor_5.0	17	37,641,855 - 37,716,592 (+)	NCBI
RGSC_v3.4	17	41,079,346 - 41,145,568 (+)	RGD
Celera	17	34,130,042 - 34,203,210 (+)	RGD

Sequence:

show sequence

GAGCCATTTTTCAGCTGCCGGCCGCAGCACCCGGGCTGCCGCCGCCGCCTCGCAATCCGTTGCA
TCGGCTGCCCCCGACGCCTCCATCCCTCCTCGGGGCCTGATATCCGTGCGGCCGGGACCCTCCT
CTCTCCAGACCCCCGATTATTTTTGGCCCCCGGGGCCTGTGCGGTGCGGAAAAATAAAAAGAAA
AGAGAGAGAGAGGGTTCGGAAGCGCCGGGAGGGGAGGCGAGAAGGAGAGACTTGGAAACTCCGG
CTGCAAATAATAAAGAAATTGAAAGCAATACGTTAATATATCGTAACACTAAAAAAGAGCAGGA
GCGAGAGATGAGAAAGGGGATCCAGCCCGCCCTGGAGCAGTACCTGGTGACCGCCGGGGGTGGG
GAGGGGGCGGCTGTCGTCGCCGCCGCCGCTGCAGCCTCCATGGACAAAAGGGCACTGCTAGCCA
GCTCCGGCTTTGCCGCCGCCGCCGCCCCGGGCACGTACATCCAGATCCTCACCACGAACCCTTC
CACCACGTCCTGTGCCACCTCCCTCCAAAGCGGCGCCCTGGCCGCCGGCCCCCTTCTCCCCAGT
GTCCCCGGCACGGAGCCGGCCGCCAGCAGCCTCCTCTACACCACGCCACAAGGACCCTCCAGCA
GAGCCGGGCTGCTACAGCAGCCACCAGCAGCAGGACGCGGCGGCGGCGGTGGCCCACCGGCAAA
GCGAAGGCTGGAGCTGGGCGAGAGTGGCCATCAGTACCTCTCAGATGGTCTAAAAACCCCCAAG
GGCAAAGGAAGAGCTGCACTACGGAGTCCTGATAGTCCAAAAACTCCAAAATCTCCCTCAGAAA
AAACGCGGTATGATACGTCACTCGGTCTGCTCACCAAGAAGTTCATTCAGCTCCTGAGCCAGTC
ACCTGATGGGGTCCTGGATCTGAACAAAGCAGCAGAGGTGCTCAAGGTGCAGAAGAGGAGGATC
TACGACATCACCAACGTGCTGGAAGGCATCCACCTCATTAAGAAGAAATCTAAGAACAACGTCC
AGTGGATCTTATGTTACATATCAAGATATTCGAAAAATTAGTGGCCTTAAAGACCAAACTGTTA
TAGTTGTGAAAGCCCCTCCAGAAACAAGACTTGAAGTGCCTGATTCAATAGAGAGCCTACAAAT
CCATTTGGCAAGTACCCAAGGGCCCATTGAGGTTTACTTGTGTCCAGAAGAGACGGAAACACAC
AGACCCATGAAAACAAATAACCAAGACCACAATGGGAATATCCCTAAGCCCACTTCCAAAGACT
TGGCTTCTAACAACTCAGGACATAGCGACTGCTCGGTTTCTACAGCAAACCTCTCTCCTCTGGC
CTCCCCAGCCAACCTTTTACAGCAGACTGAGGACCAAATTCCTTCCAACCTTGAAGGACCTTTT
GTGAACTTACTGCCTCCCCTGCTCCAAGAGGACTATCTGCTGAGCCTTGGGGAGGAAGAGGGCA
TCAGCGATCTCTTTGATGCCTATGATCTAGAAAAGCTGCCCCTCGTGGAGGACTTCATGTGTAG
TTGATTGGGCTTTGTACAAACTGTCCTTATAAACCAATTATTTTTTTATCACGGAATCAGAACG
TGTATCGCAGTGTTGTCCCTTCCTACCTTCTTCCTCCAAGAGTATCATGAAGTAAACTTCAGAA
CAAAGCTGACATTTTGATGAATTAATTTTTTTTTTCTAAGCGCACAGTTGTGGGCTCCCTTGGG
AAAAGCCCTGCCTGGTCCCAGGCTCCCAAATCTTCCTGACGAGTCAGCAAGTGAGAAGATGTGC
AATCAGGTGTCTCTCACCTGTCCTTTTCTGCCCTCCTTCCTCTGCTTTCCTTGCAGACTGGCTT
GCTGTGCCTGGTGGACGGGCTGTGGGATGGGTCCGGCCCCCTGGCCCACTGGAGAACGGCCCCC
CTGACAGCATTTCAAGCCGTGCCTTCTCTGCAGAATGCATGTTTGTGAGTCTGCTAACATGGAA
TGGAATTCTGCCACAAATGCAAGCTTGAAGTCATGC

hide sequence

RefSeq Acc Id:

XM_039095500 ⟹ XP_038951428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,810,365 - 34,887,722 (+)	NCBI
mRatBN7.2	17	34,601,761 - 34,679,139 (+)	NCBI

RefSeq Acc Id:

XM_039095503 ⟹ XP_038951431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,860,557 - 34,887,722 (+)	NCBI
mRatBN7.2	17	34,648,520 - 34,679,139 (+)	NCBI

RefSeq Acc Id:

XM_039095504 ⟹ XP_038951432

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,860,557 - 34,887,722 (+)	NCBI
mRatBN7.2	17	34,648,519 - 34,679,139 (+)	NCBI

RefSeq Acc Id:

XM_039095505 ⟹ XP_038951433

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,811,491 - 34,887,722 (+)	NCBI
mRatBN7.2	17	34,603,550 - 34,679,136 (+)	NCBI

RefSeq Acc Id:

XM_039095506 ⟹ XP_038951434

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,811,490 - 34,887,722 (+)	NCBI
mRatBN7.2	17	34,603,550 - 34,679,136 (+)	NCBI

RefSeq Acc Id:

XM_039095507 ⟹ XP_038951435

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	34,810,355 - 34,883,073 (+)	NCBI
mRatBN7.2	17	34,601,756 - 34,674,486 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001131098	(Get FASTA)	NCBI Sequence Viewer
	XP_038951428	(Get FASTA)	NCBI Sequence Viewer
	XP_038951431	(Get FASTA)	NCBI Sequence Viewer
	XP_038951432	(Get FASTA)	NCBI Sequence Viewer
	XP_038951433	(Get FASTA)	NCBI Sequence Viewer
	XP_038951434	(Get FASTA)	NCBI Sequence Viewer
	XP_038951435	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98381	(Get FASTA)	NCBI Sequence Viewer
	EDL98382	(Get FASTA)	NCBI Sequence Viewer
	EDL98383	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000040345.4
	ENSRNOP00000068682.2
	ENSRNOP00000071597.2

RefSeq Acc Id:

NP_001131098 ⟸ NM_001137626

- UniProtKB:

A0A0G2K0V6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASSGFAAAAAPGTYIQILTTNPSTT
SCATSLQSGALAAGPLLPSVPGTEPAASSLLYTTPQGPSSRAGLLQQPPAAGRGGGGGPPAKRR
LELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLTKKFIQLLSQSPD
GVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWILCYISRYSKN

hide sequence

Ensembl Acc Id:

ENSRNOP00000071597 ⟸ ENSRNOT00000081368

Ensembl Acc Id:

ENSRNOP00000068682 ⟸ ENSRNOT00000091334

Ensembl Acc Id:

ENSRNOP00000040345 ⟸ ENSRNOT00000050261

RefSeq Acc Id:	XP_038951435 ⟸ XM_039095507
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038951428 ⟸ XM_039095500
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038951433 ⟸ XM_039095505
- Peptide Label:	isoform X4
- UniProtKB:	A0A0G2JTE8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038951434 ⟸ XM_039095506
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038951432 ⟸ XM_039095504
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038951431 ⟸ XM_039095503
- Peptide Label:	isoform X2

Protein Domains

E2F/DP family winged-helix DNA-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K0V6-F1-model_v2	AlphaFold	A0A0G2K0V6	1-426	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700430

Promoter ID:

EPDNEW_R10954

Type:

initiation region

Name:

E2f3_2

Description:

E2F transcription factor 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10955

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	36,334,111 - 36,334,171	EPDNEW

RGD ID:

13700433

Promoter ID:

EPDNEW_R10955

Type:

single initiation site

Name:

E2f3_1

Description:

E2F transcription factor 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10954

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	36,335,864 - 36,335,924	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561600	AgrOrtholog
BioCyc Gene	G2FUF-9524	BioCyc
Ensembl Genes	ENSRNOG00000029273	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050261.6	UniProtKB/TrEMBL
	ENSRNOT00000081368.2	UniProtKB/TrEMBL
	ENSRNOT00000091334.2	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.10	UniProtKB/TrEMBL
	6.10.250.540	UniProtKB/TrEMBL
InterPro	E2F	UniProtKB/TrEMBL
	E2F-DP_heterodim	UniProtKB/TrEMBL
	E2F_CC-MB	UniProtKB/TrEMBL
	E2F_TDP	UniProtKB/TrEMBL
	WH-like_DNA-bd_sf	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:291105	UniProtKB/TrEMBL
NCBI Gene	291105	ENTREZGENE
PANTHER	E2F	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR E2F3	UniProtKB/TrEMBL
Pfam	E2F_CC-MB	UniProtKB/TrEMBL
	E2F_TDP	UniProtKB/TrEMBL
PhenoGen	E2f3	PhenoGen
RatGTEx	ENSRNOG00000029273	RatGTEx
SMART	E2F_TDP	UniProtKB/TrEMBL
Superfamily-SCOP	SSF144074	UniProtKB/TrEMBL
	SSF46785	UniProtKB/TrEMBL
UniProt	A0A0G2JTE8	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K0V6	ENTREZGENE, UniProtKB/TrEMBL
	A6J7N1_RAT	UniProtKB/TrEMBL
	D4ADR2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	E2f3	E2F transcription factor 3	LOC100361421	E2F transcription factor 3-like	Data merged from RGD:2320144	737654	PROVISIONAL
2013-05-24	E2f3	E2F transcription factor 3	LOC691420	similar to Transcription factor E2F3 (E2F-3)	Data merged from RGD:1583953	1643240	APPROVED
2010-05-05	LOC100361421	E2F transcription factor 3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-02-29	E2f3	E2F transcription factor 3	RGD1561600_predicted	similar to E2f3 protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC691420	similar to Transcription factor E2F3 (E2F-3)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-03-07	RGD1561600_predicted	similar to E2f3 protein (predicted)	LOC291105	similar to E2f3 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC291105	similar to E2f3 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)