Advanced Search (OLGA)

Gene: Rpl39l1 (ribosomal protein L39 like 1) Rattus norvegicus

Analyze

Symbol:

Rpl39l1

Name:

ribosomal protein L39 like 1

RGD ID:

1561345

Description:

Predicted to be a structural constituent of ribosome. Predicted to be involved in cytoplasmic translation and spermatogenesis. Predicted to be part of cytosolic large ribosomal subunit. Orthologous to human RPL39L (ribosomal protein L39 like); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC497860; MGC125234; ribosomal protein L39-like; ribosomal protein L39-like protein; Rpl39l; similar to RIKEN cDNA 4930517K11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL39L (ribosomal protein L39 like)	HGNC	Ensembl, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Rpl39l (ribosomal protein L39-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL39L (ribosomal protein L39 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC100682542 (60S ribosomal protein L39)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100525679 (60S ribosomal protein L39)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL39L (ribosomal protein L39 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPL39L (ribosomal protein L39 like)	Alliance	DIOPT (HGNC\|OMA\|OrthoFinder\|PANTHER)
Mus musculus (house mouse):	Rpl39l (ribosomal protein L39-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpl39 (ribosomal protein L39)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rpl-39	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL39	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL39	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpl39	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	5,962,506 - 5,966,621 (-)	NCBI		GRCr8
mRatBN7.2	10	5,455,712 - 5,459,828 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	5,454,559 - 5,462,029 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	10,151,694 - 10,155,820 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	9,673,153 - 9,677,269 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	5,311,187 - 5,315,326 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	5,529,580 - 5,533,695 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	5,529,589 - 5,533,695 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	4,350,262 - 4,354,377 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	5,409,437 - 5,413,552 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	4,471,705 - 4,475,820 (-)	NCBI		Celera
Cytogenetic Map	10	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3MC syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-hydroxypropanoic acid (ISO)

aflatoxin B1 (ISO)

aldrin (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

chloroethene (ISO)

cobalt dichloride (ISO)

coumestrol (ISO)

Cuprizon (EXP)

dextran sulfate (ISO)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diclofenac (ISO)

diethylstilbestrol (EXP)

Enterolactone (ISO)

glycidol (EXP)

indometacin (ISO)

lead diacetate (ISO)

methamphetamine (ISO)

methapyrilene (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

picoxystrobin (ISO)

potassium chromate (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

triptonide (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoplasmic translation (ISO)

spermatogenesis (ISO)

Cellular Component

cytosolic large ribosomal subunit (IBA,ISO)

Molecular Function

protein binding (ISO)

structural constituent of ribosome (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:12490704

Genomics

Comparative Map Data

Rpl39l1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	5,962,506 - 5,966,621 (-)	NCBI		GRCr8
mRatBN7.2	10	5,455,712 - 5,459,828 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	5,454,559 - 5,462,029 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	10,151,694 - 10,155,820 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	9,673,153 - 9,677,269 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	5,311,187 - 5,315,326 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	5,529,580 - 5,533,695 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	5,529,589 - 5,533,695 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	4,350,262 - 4,354,377 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	5,409,437 - 5,413,552 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	4,471,705 - 4,475,820 (-)	NCBI		Celera
Cytogenetic Map	10	q11	NCBI

RPL39L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	187,120,948 - 187,139,496 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	187,120,948 - 187,180,908 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	186,838,736 - 186,857,284 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	188,321,435 - 188,339,957 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	188,321,442 - 188,339,965	NCBI
Celera	3	185,270,573 - 185,289,095 (-)	NCBI		Celera
Cytogenetic Map	3	q27.3	NCBI
HuRef	3	184,243,217 - 184,261,742 (-)	NCBI		HuRef
CHM1_1	3	186,802,108 - 186,820,629 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	189,938,378 - 189,956,928 (-)	NCBI		T2T-CHM13v2.0

Rpl39l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	9,988,061 - 9,992,775 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	9,988,090 - 9,992,775 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	10,170,197 - 10,174,911 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	10,170,226 - 10,174,911 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	10,170,321 - 10,175,004 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	10,083,806 - 10,088,489 (+)	NCBI		MGSCv36	mm8
Celera	16	10,803,453 - 10,808,136 (+)	NCBI		Celera
Cytogenetic Map	16	A1	NCBI
cM Map	16	5.49	NCBI

RPL39L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	184,990,800 - 185,009,429 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	184,995,517 - 185,014,111 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	184,146,722 - 184,165,326 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	192,612,140 - 192,630,507 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	192,612,337 - 192,612,492 (-)	Ensembl	panpan1.1		panPan2

LOC100682542
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	49,680,765 - 49,681,175 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	49,535,774 - 49,536,185 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	50,554,149 - 50,554,547 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	10	50,261,380 - 50,261,791 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	50,548,040 - 50,548,451 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	50,735,942 - 50,736,353 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100525679
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	98,178,150 - 98,181,332 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	14,814,759 - 14,815,155 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	16,026,697 - 16,027,096 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL39L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1 Ensembl	15	81,390,733 - 81,390,885 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	54,880,086 - 54,899,943 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Rpl39l1
28 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	92
Count of miRNA genes:	76
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000051564
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	46	107	79	78	51	18	51	5	185	78	91	39	60	27

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001195471	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103490	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051564 ⟹ ENSRNOP00000040295

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	5,455,245 - 5,462,029 (-)	Ensembl
Rnor_6.0 Ensembl	10	5,529,589 - 5,533,695 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105843 ⟹ ENSRNOP00000095440

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	5,454,559 - 5,459,994 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118208 ⟹ ENSRNOP00000091729

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	5,455,195 - 5,460,501 (-)	Ensembl

RefSeq Acc Id:

NM_001195471 ⟹ NP_001182400

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	5,962,506 - 5,966,621 (-)	NCBI
mRatBN7.2	10	5,455,712 - 5,459,828 (-)	NCBI
Rnor_6.0	10	5,529,580 - 5,533,695 (-)	NCBI
Rnor_5.0	10	4,350,262 - 4,354,377 (-)	NCBI
Celera	10	4,471,705 - 4,475,820 (-)	NCBI

Sequence:

show sequence

CGCTATCCTGGTGTGTGGTCCTGGGCTCCGGCTGTGCAGCGCTCACAGGGAACCTGGCAGAGTC
AGGCACTCAACTCTGTCCTGCCTTTCCAAGCTATTCTAATCCACTGGCTTAGACTCACCGGGAG
GAGTGTGTGCCTGTCTGACTTTGTTCTTCGCCATGGCTTCTCACAAGACCTTCAGAATCAAGCG
CTTCCTGGCTAAGAAACAAAAGCAAAATCGTCCGATTCCACAATGGATTCAGATGAAAACCGGC
AATAAAATCATGTACAACTCCAAGCGGAGACACTGGAGACGAACCAAATTGGGTCTATAAGGAA
CCACACACCACACGTACTTACTAAGCTGTCTGAGGGTTATCATTAACATACTGTACCAGGATCA
CAGCATTACCATTGTCTGGACAGCTGAGTATGTTCATTAGGAATGTTTTCTTTCTTTCTGTGCT
CTTGTGGGTTCATTCAGTAGTTGAATAATAAATATGGGAAACCTTTTGTTTAGAAGAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001182400	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI03491	(Get FASTA)	NCBI Sequence Viewer
	EDL96232	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000040295.2
	ENSRNOP00000091729.1
	ENSRNOP00000095440.1

RefSeq Acc Id:	NP_001182400 ⟸ NM_001195471
- UniProtKB:	Q3ZB89 (UniProtKB/TrEMBL), A0A8I6ATH3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASHKTFRIKRFLAKKQKQNRPIPQWIQMKTGNKIMYNSKRRHWRRTKLGL hide sequence

Ensembl Acc Id:

ENSRNOP00000040295 ⟸ ENSRNOT00000051564

Ensembl Acc Id:

ENSRNOP00000091729 ⟸ ENSRNOT00000118208

Ensembl Acc Id:

ENSRNOP00000095440 ⟸ ENSRNOT00000105843

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3ZB89-F1-model_v2	AlphaFold	Q3ZB89	1-51	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696948

Promoter ID:

EPDNEW_R7473

Type:

multiple initiation site

Name:

Rpl39l_1

Description:

ribosomal protein L39-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	5,533,716 - 5,533,776	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561345	AgrOrtholog
BioCyc Gene	G2FUF-26125	BioCyc
Ensembl Genes	ENSRNOG00000032300	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000051564.3	UniProtKB/TrEMBL
	ENSRNOT00000105843.1	UniProtKB/TrEMBL
	ENSRNOT00000118208.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.1620.10	UniProtKB/TrEMBL
InterPro	Ribosomal_L39	UniProtKB/TrEMBL
	Ribosomal_L39_CS	UniProtKB/TrEMBL
	Ribosomal_L39e_dom	UniProtKB/TrEMBL
KEGG Report	rno:497860	UniProtKB/TrEMBL
NCBI Gene	497860	ENTREZGENE
PANTHER	60S RIBOSOMAL PROTEIN L39-LIKE	UniProtKB/TrEMBL
	RIBOSOMAL PROTEIN L39E	UniProtKB/TrEMBL
Pfam	Ribosomal_L39	UniProtKB/TrEMBL
PhenoGen	Rpl39l1	PhenoGen
PROSITE	RIBOSOMAL_L39E	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000032300	RatGTEx
Superfamily-SCOP	Ribosomal_L39	UniProtKB/TrEMBL
UniProt	A0A8I6ATH3	ENTREZGENE, UniProtKB/TrEMBL
	Q3ZB89	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-07-21	Rpl39l1	ribosomal protein L39 like 1	Rpl39l	ribosomal protein L39-like	Name and Symbol changed	629549	APPROVED
2012-09-18	Rpl39l	ribosomal protein L39-like	LOC497860	similar to RIKEN cDNA 4930517K11	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC497860	similar to RIKEN cDNA 4930517K11			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar