Tmem208 (transmembrane protein 208)

Advanced Search (OLGA)

Gene: Tmem208 (transmembrane protein 208) Rattus norvegicus

Analyze

Symbol:

Tmem208

Name:

transmembrane protein 208

RGD ID:

1560953

Description:

Predicted to be involved in vacuolar protein processing. Predicted to be located in endoplasmic reticulum membrane and vacuole. Orthologous to human TMEM208 (transmembrane protein 208); INTERACTS WITH 6-propyl-2-thiouracil; amitrole; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Hspc171; LOC291963; RGD1560953; similar to HSPC171 protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TMEM208 (transmembrane protein 208)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tmem208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tmem208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TMEM208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TMEM208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tmem208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TMEM208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TMEM208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tmem208 (transmembrane protein 208)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Tmem208 (transmembrane protein 208)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TMEM208 (transmembrane protein 208)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:77041	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	R05D11.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG8320	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SND2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	tmem208	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,113,494 - 50,116,210 (+)	NCBI		GRCr8
mRatBN7.2	19	33,203,587 - 33,206,287 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,203,587 - 33,212,183 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,019,195 - 40,021,895 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,672,520 - 40,675,220 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	42,961,402 - 42,964,104 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,282,018 - 37,284,718 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,282,018 - 37,284,718 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,147,514 - 48,150,214 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,141,373 - 35,144,073 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	32,632,189 - 32,634,889 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant dyskeratosis congenita 6 (ISO)

Chromosome 16q12 Duplication Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

amitrole (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlormequat chloride (EXP)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

disodium selenite (ISO)

disulfiram (ISO)

doxorubicin (ISO)

folic acid (ISO)

glafenine (EXP)

indometacin (ISO)

isotretinoin (ISO)

methimazole (EXP)

nefazodone (EXP)

nimesulide (EXP)

propiconazole (EXP)

quercitrin (ISO)

rac-lactic acid (ISO)

senecionine (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

testosterone (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

vacuolar protein processing (IBA)

Cellular Component

endoplasmic reticulum membrane (IEA,ISO)

vacuole (IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Tmem208
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	50,113,494 - 50,116,210 (+)	NCBI		GRCr8
mRatBN7.2	19	33,203,587 - 33,206,287 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,203,587 - 33,212,183 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,019,195 - 40,021,895 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,672,520 - 40,675,220 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	42,961,402 - 42,964,104 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	37,282,018 - 37,284,718 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,282,018 - 37,284,718 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,147,514 - 48,150,214 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,141,373 - 35,144,073 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	19	32,632,189 - 32,634,889 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

TMEM208
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,227,130 - 67,229,278 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	67,227,103 - 67,229,278 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	67,261,033 - 67,263,181 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	65,818,517 - 65,820,683 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	51,769,250 - 51,771,416 (+)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,134,194 - 53,136,360 (+)	NCBI		HuRef
CHM1_1	16	68,668,344 - 68,670,510 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	73,021,414 - 73,023,562 (+)	NCBI		T2T-CHM13v2.0

Tmem208
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	106,052,980 - 106,062,117 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	106,052,986 - 106,061,851 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,326,341 - 105,335,485 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,326,354 - 105,335,219 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	107,850,264 - 107,852,957 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,215,507 - 108,218,184 (+)	NCBI		MGSCv36	mm8
Celera	8	109,549,513 - 109,552,206 (+)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.04	NCBI

Tmem208
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	9,396,688 - 9,398,953 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	9,396,688 - 9,398,953 (-)	NCBI	ChiLan1.0	ChiLan1.0

TMEM208
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	76,756,724 - 76,758,900 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	82,669,306 - 82,671,482 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	47,572,655 - 47,574,836 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	66,961,504 - 66,963,680 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	66,961,504 - 66,963,680 (+)	Ensembl	panpan1.1		panPan2

TMEM208
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	82,145,725 - 82,147,704 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	82,145,761 - 82,147,629 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	82,135,239 - 82,137,226 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	82,580,911 - 82,582,898 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	82,580,952 - 82,582,820 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	82,407,007 - 82,408,994 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	82,092,557 - 82,094,544 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,731,829 - 82,733,816 (-)	NCBI		UU_Cfam_GSD_1.0

Tmem208
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	41,894,966 - 41,896,915 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	17,692,229 - 17,698,169 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	17,692,252 - 17,694,148 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMEM208
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	27,853,452 - 27,867,226 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	27,864,337 - 27,867,229 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	25,104,277 - 25,107,156 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMEM208
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	60,227,144 - 60,229,181 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	60,227,147 - 60,228,575 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	22,979,113 - 22,981,266 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmem208
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	19,090,985 - 19,093,273 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	19,090,985 - 19,093,278 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmem208
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	50
Count of miRNA genes:	46
Interacting mature miRNAs:	49
Transcripts:	ENSRNOT00000021723
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021723 ⟹ ENSRNOP00000021722

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,203,587 - 33,206,287 (+)	Ensembl
Rnor_6.0 Ensembl	19	37,282,018 - 37,284,718 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097234 ⟹ ENSRNOP00000085464

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,203,587 - 33,212,183 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101803 ⟹ ENSRNOP00000096857

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,204,274 - 33,206,287 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103939 ⟹ ENSRNOP00000094053

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,203,587 - 33,206,298 (+)	Ensembl

RefSeq Acc Id:

NM_001106179 ⟹ NP_001099649

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,113,510 - 50,116,210 (+)	NCBI
mRatBN7.2	19	33,203,587 - 33,206,287 (+)	NCBI
Rnor_6.0	19	37,282,018 - 37,284,718 (+)	NCBI
Rnor_5.0	19	48,147,514 - 48,150,214 (+)	NCBI
RGSC_v3.4	19	35,141,373 - 35,144,073 (+)	RGD
Celera	19	32,632,189 - 32,634,889 (+)	RGD

Sequence:

show sequence

CCACTTCCGTCCAGAATCCTGACGAGTTTGGTCTGTACCGGAAGTGCATGGGCTGCCGATGTGG
TGTCTACTGACTGCAGTTCCAGTTACTCGCCCTTGTTTCGGTGGCTGGGTATTTGCTTCGCACC
ATGGCGCCCAAAGGCAAAGTGGGTACAAGAGGGAAGAAGCAGATATTTGAAGAGAACAAAGAAA
CTCTCAAGTTTTACCTTCGGATCATTCTGGGAGCCAATGCCATCTACTGCCTTGTGACCTTGGC
TTTCTTCTATTCATCTGCCTCATTCTGGGCCTGGATGGCCCTGGCCTTCAGCTTGGCCGTGTAC
GGGGCCAGCTACCACTCTATGAGCTCAATGGCTCGGGCATCCTTCTCTGAGGACGGGTCCTTGG
TGGACGGTGGCATGGACCTCAACATGGAGCAGGGCATGGCAGAGCACCTTAAGGATGTGATCCT
ACTGACAGCCATTGTTCAGGTGCTCAGCTGTCTCTCCCTCTACATCTGGTCCTTCTGGCTTCTG
GCTCCAGGCCGGGCCCTTTACCTCTTGTGGGTAAACGTGCTGGGCCCCTGGTTCGCAGCAGACA
GTGGAGCCCCAGCACCAGAGCTCAATGAAAAACGACAACGCCGACAGGAACGGCGCCAGATGAA
AAGGTTATAGCGTCTCTACTGTGGCTGTAGGCTGCTGGGTGCTGGTTGGCTCTATTAGGATGTA
TGGCCCCATGCCTGGAGCAGTGAGGGCCTAGGTTAAGGGCCAAAAGAAGCCTGAATTATAGGAT
TACTAAATAAATAGTTTCGAATGTGGCTAA

hide sequence

RefSeq Acc Id:

XM_039097607 ⟹ XP_038953535

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,113,494 - 50,116,210 (+)	NCBI
mRatBN7.2	19	33,203,590 - 33,206,287 (+)	NCBI

RefSeq Acc Id:

XM_063277912 ⟹ XP_063133982

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	50,113,495 - 50,115,823 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099649	(Get FASTA)	NCBI Sequence Viewer
	XP_038953535	(Get FASTA)	NCBI Sequence Viewer
	XP_063133982	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92369	(Get FASTA)	NCBI Sequence Viewer
	EDL92370	(Get FASTA)	NCBI Sequence Viewer
	EDL92371	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021722.4
	ENSRNOP00000085464.1
	ENSRNOP00000094053.1
	ENSRNOP00000096857.1

RefSeq Acc Id:	NP_001099649 ⟸ NM_001106179
- UniProtKB:	D4A266 (UniProtKB/TrEMBL), A6IYP1 (UniProtKB/TrEMBL), A0A8I6AVP2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAPKGKVGTRGKKQIFEENKETLKFYLRIILGANAIYCLVTLAFFYSSASFWAWMALAFSLAVY GASYHSMSSMARASFSEDGSLVDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCLSLYIWSFWLL APGRALYLLWVNVLGPWFAADSGAPAPELNEKRQRRQERRQMKRL hide sequence

Ensembl Acc Id:

ENSRNOP00000021722 ⟸ ENSRNOT00000021723

RefSeq Acc Id:	XP_038953535 ⟸ XM_039097607
- Peptide Label:	isoform X1
- UniProtKB:	A6IYP2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085464 ⟸ ENSRNOT00000097234

Ensembl Acc Id:

ENSRNOP00000096857 ⟸ ENSRNOT00000101803

Ensembl Acc Id:

ENSRNOP00000094053 ⟸ ENSRNOT00000103939

RefSeq Acc Id:	XP_063133982 ⟸ XM_063277912
- Peptide Label:	isoform X2
- UniProtKB:	A6IYP3 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A266-F1-model_v2	AlphaFold	D4A266	1-173	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701073

Promoter ID:

EPDNEW_R11596

Type:

initiation region

Name:

Tmem208_1

Description:

transmembrane protein 208

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	37,282,065 - 37,282,125	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560953	AgrOrtholog
BioCyc Gene	G2FUF-5836	BioCyc
Ensembl Genes	ENSRNOG00000015974	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021723.6	UniProtKB/TrEMBL
	ENSRNOT00000097234.1	UniProtKB/TrEMBL
	ENSRNOT00000101803.1	UniProtKB/TrEMBL
	ENSRNOT00000103939.1	UniProtKB/TrEMBL
InterPro	DUF788	UniProtKB/TrEMBL
KEGG Report	rno:291963	UniProtKB/TrEMBL
NCBI Gene	291963	ENTREZGENE
PANTHER	DUF788	UniProtKB/TrEMBL
	TRANSMEMBRANE PROTEIN 208	UniProtKB/TrEMBL
Pfam	DUF788	UniProtKB/TrEMBL
PhenoGen	Tmem208	PhenoGen
RatGTEx	ENSRNOG00000015974	RatGTEx
UniProt	A0A8I6AGY1_RAT	UniProtKB/TrEMBL
	A0A8I6AVP2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GDQ0_RAT	UniProtKB/TrEMBL
	A6IYP1	ENTREZGENE, UniProtKB/TrEMBL
	A6IYP2	ENTREZGENE, UniProtKB/TrEMBL
	A6IYP3	ENTREZGENE, UniProtKB/TrEMBL
	D4A266	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-19	Tmem208	transmembrane protein 208	Hspc171	HSPC171 protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-28	Hspc171	HSPC171 protein	RGD1560953_predicted	similar to HSPC171 protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560953_predicted	similar to HSPC171 protein (predicted)	LOC291963	similar to HSPC171 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC291963	similar to HSPC171 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar