Advanced Search (OLGA)

Gene: Zbtb20 (zinc finger and BTB domain containing 20) Rattus norvegicus

Analyze

Symbol:

Zbtb20

Name:

zinc finger and BTB domain containing 20

RGD ID:

1560387

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including cellular response to glucose stimulus; positive regulation of metabolic process; and regulation of gene expression. Predicted to be located in cytoplasm and nuclear body. Predicted to be active in nucleoplasm. Orthologous to human ZBTB20 (zinc finger and BTB domain containing 20); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC288105; RGD1560387; similar to Zbtb20 protein; zinc finger and BTB domain-containing protein 20

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Zbtb20^{Tn(pb-Bhr7)1Wmukf}

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	70,558,010 - 71,297,039 (-)	NCBI		GRCr8
mRatBN7.2	11	57,052,129 - 57,791,214 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	57,072,880 - 57,510,210 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	65,865,277 - 66,604,324 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	58,527,515 - 59,266,582 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	57,583,947 - 58,333,500 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	62,014,925 - 62,561,113 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	62,014,925 - 62,451,184 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	61,127,464 - 61,865,305 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	58,662,837 - 59,399,213 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	56,625,650 - 57,340,896 (-)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	COVID-19		ISO	RGD:1351632	9068941	mRNA:decreased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226\|REF_RGD_ID:28912744

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	autism spectrum disorder		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:25741868
Zbtb20	Rat	autistic disorder		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Autistic behavior	ClinVar	PMID:25741868
Zbtb20	Rat	genetic disease		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:10940247\|PMID:25017102\|PMID:25741868\|PMID:28462983\|PMID:28492532\|PMID:31321892\|PMID:32565546
Zbtb20	Rat	intellectual disability		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:25741868\|PMID:28492532
Zbtb20	Rat	Marfanoid Mental Retardation Syndrome, Autosomal		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Marfanoid habitus and intellectual disability	ClinVar	PMID:25741868
Zbtb20	Rat	Neurodevelopmental Disorders		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Zbtb20	Rat	Primrose Syndrome		ISO	RGD:1351632	8554872	ClinVar Annotator: match by term: Ossified ear cartilages with mental deficiency, muscle wasting, and bony more ...	ClinVar	PMID:21567911\|PMID:21910247\|PMID:25017102\|PMID:25741868\|PMID:27061120\|PMID:28327206\|PMID:28462983\|PMID:28492532\|PMID:29737001\|PMID:30256248\|PMID:30637921\|PMID:31321892\|PMID:32071410\|PMID:32266967\|PMID:38177409\|PMID:6809950

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	pre-malignant neoplasm		ISO	RGD:1351632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28220687
Zbtb20	Rat	Primrose Syndrome		ISO	RGD:1351632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25017102
Zbtb20	Rat	Prostatic Neoplasms		ISO	RGD:1351632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:28319090
Zbtb20	Rat	Stomach Neoplasms		ISO	RGD:1351632	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:22037551

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	Primrose Syndrome		ISO	RGD:1351632	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:1557085	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Zbtb20	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1557085	6480464	ethylene dichloride results in decreased expression of ZBTB20 mRNA	CTD	PMID:28189721\|PMID:28960355
Zbtb20	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1557085	6480464	1,2-Dimethylhydrazine results in decreased expression of ZBTB20 mRNA	CTD	PMID:22206623
Zbtb20	Rat	17alpha-ethynylestradiol	decreases expression	EXP		6480464	Ethinyl Estradiol results in decreased expression of ZBTB20 mRNA	CTD	PMID:17557909
Zbtb20	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1557085	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Zbtb20	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1557085	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Zbtb20	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of ZBTB20 mRNA	CTD	PMID:22298810\|PMID:34747641
Zbtb20	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of ZBTB20 mRNA	CTD	PMID:32109520
Zbtb20	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1557085	6480464	Tetrachlorodibenzodioxin affects the expression of ZBTB20 mRNA	CTD	PMID:21570461
Zbtb20	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1557085	6480464	Tetrachlorodibenzodioxin results in increased expression of ZBTB20 mRNA	CTD	PMID:21354282
Zbtb20	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:1557085	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Zbtb20	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of ZBTB20 mRNA	CTD	PMID:21346803
Zbtb20	Rat	2-butoxyethanol	decreases expression	ISO	RGD:1557085	6480464	n-butoxyethanol results in decreased expression of ZBTB20 mRNA	CTD	PMID:19812364
Zbtb20	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1351632	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Zbtb20	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1351632	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Zbtb20	Rat	4,4'-sulfonyldiphenol	increases methylation	ISO	RGD:1351632	6480464	bisphenol S results in increased methylation of ZBTB20 gene	CTD	PMID:31601247
Zbtb20	Rat	4,4'-sulfonyldiphenol	affects expression	ISO	RGD:1557085	6480464	bisphenol S affects the expression of ZBTB20 mRNA	CTD	PMID:39298647
Zbtb20	Rat	4-hydroxynon-2-enal	increases expression	ISO	RGD:1557085	6480464	4-hydroxy-2-nonenal results in increased expression of ZBTB20 mRNA	CTD	PMID:19191707
Zbtb20	Rat	5-fluorouracil	decreases expression	ISO	RGD:1351632	6480464	Fluorouracil results in decreased expression of ZBTB20 mRNA	CTD	PMID:16510598
Zbtb20	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of ZBTB20 mRNA	CTD	PMID:30047161
Zbtb20	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of ZBTB20 mRNA	CTD	PMID:28959563
Zbtb20	Rat	aflatoxin B1	decreases expression	ISO	RGD:1557085	6480464	Aflatoxin B1 results in decreased expression of ZBTB20 mRNA	CTD	PMID:19770486
Zbtb20	Rat	aflatoxin B1	increases methylation	ISO	RGD:1351632	6480464	Aflatoxin B1 results in increased methylation of ZBTB20 intron	CTD	PMID:30157460
Zbtb20	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1351632	6480464	Aflatoxin B1 results in decreased methylation of ZBTB20 gene	CTD	PMID:27153756
Zbtb20	Rat	aflatoxin B1	decreases expression	ISO	RGD:1351632	6480464	Aflatoxin B1 results in decreased expression of ZBTB20 mRNA	CTD	PMID:22100608
Zbtb20	Rat	aflatoxin B1	increases expression	ISO	RGD:1351632	6480464	Aflatoxin B1 results in increased expression of ZBTB20 mRNA	CTD	PMID:21641981
Zbtb20	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1351632	6480464	Tretinoin results in increased expression of ZBTB20 mRNA	CTD	PMID:23724009
Zbtb20	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of ZBTB20 mRNA	CTD	PMID:30047161
Zbtb20	Rat	arsane	affects methylation	ISO	RGD:1351632	6480464	Arsenic affects the methylation of ZBTB20 gene	CTD	PMID:25304211
Zbtb20	Rat	arsenic atom	affects methylation	ISO	RGD:1351632	6480464	Arsenic affects the methylation of ZBTB20 gene	CTD	PMID:25304211
Zbtb20	Rat	atrazine	increases expression	ISO	RGD:1351632	6480464	Atrazine results in increased expression of ZBTB20 mRNA	CTD	PMID:22378314
Zbtb20	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1557085	6480464	Benzo(a)pyrene results in decreased expression of ZBTB20 mRNA	CTD	PMID:19770486
Zbtb20	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1351632	6480464	Benzo(a)pyrene results in increased methylation of ZBTB20 promoter	CTD	PMID:27901495
Zbtb20	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1351632	6480464	Benzo(a)pyrene affects the methylation of ZBTB20 5' UTR; Benzo(a)pyrene affects the methylation of ZBTB20 intron	CTD	PMID:27901495\|PMID:30157460
Zbtb20	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1351632	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of ZBTB20 mRNA	CTD	PMID:20018196
Zbtb20	Rat	benzo[b]fluoranthene	decreases expression	ISO	RGD:1557085	6480464	benzo(b)fluoranthene results in decreased expression of ZBTB20 mRNA	CTD	PMID:26377693
Zbtb20	Rat	bilirubin IXalpha	decreases expression	ISO	RGD:1351632	6480464	Bilirubin results in decreased expression of ZBTB20 mRNA	CTD	PMID:20196124
Zbtb20	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1557085	6480464	Diethylhexyl Phthalate results in increased expression of ZBTB20 mRNA	CTD	PMID:33754040
Zbtb20	Rat	bisphenol A	decreases expression	ISO	RGD:1351632	6480464	bisphenol A results in decreased expression of ZBTB20 mRNA	CTD	PMID:22576693
Zbtb20	Rat	bisphenol A	decreases methylation	ISO	RGD:1351632	6480464	bisphenol A results in decreased methylation of ZBTB20 gene	CTD	PMID:31601247
Zbtb20	Rat	bisphenol A	increases expression	ISO	RGD:1557085	6480464	bisphenol A results in increased expression of ZBTB20 mRNA	CTD	PMID:35598803
Zbtb20	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ZBTB20 mRNA	CTD	PMID:33296240
Zbtb20	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of ZBTB20 mRNA	CTD	PMID:30816183
Zbtb20	Rat	bisphenol A	multiple interactions	ISO	RGD:1351632	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Zbtb20	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of ZBTB20 gene	CTD	PMID:28505145
Zbtb20	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ZBTB20 mRNA	CTD	PMID:25181051\|PMID:34947998
Zbtb20	Rat	bisphenol A	increases methylation	ISO	RGD:1351632	6480464	bisphenol A results in increased methylation of ZBTB20 gene	CTD	PMID:22576693
Zbtb20	Rat	bisphenol F	multiple interactions	ISO	RGD:1351632	6480464	[bisphenol F co-treated with Fulvestrant] results in decreased methylation of ZBTB20 gene; [INS protein co-treated more ...	CTD	PMID:28628672\|PMID:31601247
Zbtb20	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of ZBTB20 mRNA	CTD	PMID:24136188
Zbtb20	Rat	butanal	decreases expression	ISO	RGD:1351632	6480464	butyraldehyde results in decreased expression of ZBTB20 mRNA	CTD	PMID:26079696
Zbtb20	Rat	C60 fullerene	increases expression	EXP		6480464	fullerene C60 results in increased expression of ZBTB20 mRNA	CTD	PMID:19167457
Zbtb20	Rat	carbon nanotube	decreases expression	ISO	RGD:1557085	6480464	Nanotubes, Carbon analog results in decreased expression of ZBTB20 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681
Zbtb20	Rat	CGP 52608	multiple interactions	ISO	RGD:1351632	6480464	CGP 52608 promotes the reaction [RORA protein binds to ZBTB20 gene]	CTD	PMID:28238834
Zbtb20	Rat	chloroprene	increases expression	EXP		6480464	Chloroprene results in increased expression of ZBTB20 mRNA	CTD	PMID:23125180
Zbtb20	Rat	choline	multiple interactions	ISO	RGD:1557085	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ...	CTD	PMID:20938992
Zbtb20	Rat	cisplatin	decreases expression	ISO	RGD:1351632	6480464	Cisplatin results in decreased expression of ZBTB20 mRNA	CTD	PMID:27392435\|PMID:27594783
Zbtb20	Rat	cisplatin	multiple interactions	ISO	RGD:1351632	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of ZBTB20 mRNA	CTD	PMID:27392435
Zbtb20	Rat	copper atom	multiple interactions	ISO	RGD:1351632	6480464	[NSC 689534 binds to Copper] which results in increased expression of ZBTB20 mRNA	CTD	PMID:20971185
Zbtb20	Rat	copper(0)	multiple interactions	ISO	RGD:1351632	6480464	[NSC 689534 binds to Copper] which results in increased expression of ZBTB20 mRNA	CTD	PMID:20971185
Zbtb20	Rat	copper(II) sulfate	increases expression	ISO	RGD:1351632	6480464	Copper Sulfate results in increased expression of ZBTB20 mRNA	CTD	PMID:19549813
Zbtb20	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of ZBTB20 mRNA	CTD	PMID:26577399
Zbtb20	Rat	cyclosporin A	increases expression	ISO	RGD:1557085	6480464	Cyclosporine results in increased expression of ZBTB20 mRNA	CTD	PMID:19770486
Zbtb20	Rat	cyclosporin A	decreases expression	ISO	RGD:1351632	6480464	Cyclosporine results in decreased expression of ZBTB20 mRNA	CTD	PMID:27989131
Zbtb20	Rat	cyclosporin A	increases methylation	ISO	RGD:1351632	6480464	Cyclosporine results in increased methylation of ZBTB20 promoter	CTD	PMID:27989131
Zbtb20	Rat	cyclosporin A	increases expression	ISO	RGD:1351632	6480464	Cyclosporine results in increased expression of ZBTB20 mRNA	CTD	PMID:25562108
Zbtb20	Rat	daunorubicin	affects response to substance	ISO	RGD:1351632	6480464	ZBTB20 affects the susceptibility to Daunorubicin	CTD	PMID:17545624
Zbtb20	Rat	DDT	decreases expression	EXP		6480464	DDT results in decreased expression of ZBTB20 mRNA	CTD	PMID:30207508
Zbtb20	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of ZBTB20 mRNA	CTD	PMID:23640034
Zbtb20	Rat	dexamethasone	multiple interactions	ISO	RGD:1351632	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Zbtb20	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1351632	6480464	di-n-butylphosphoric acid affects the expression of ZBTB20 mRNA	CTD	PMID:37042841
Zbtb20	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of ZBTB20 mRNA	CTD	PMID:21266533
Zbtb20	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of ZBTB20 mRNA	CTD	PMID:21266533
Zbtb20	Rat	dibutyl phthalate	increases expression	ISO	RGD:1557085	6480464	Dibutyl Phthalate results in increased expression of ZBTB20 mRNA	CTD	PMID:21266533
Zbtb20	Rat	dioxygen	increases expression	ISO	RGD:1557085	6480464	Oxygen deficiency results in increased expression of ZBTB20 mRNA	CTD	PMID:24205000
Zbtb20	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of ZBTB20 mRNA	CTD	PMID:25152437
Zbtb20	Rat	dorsomorphin	multiple interactions	ISO	RGD:1351632	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Zbtb20	Rat	doxorubicin	decreases expression	ISO	RGD:1557085	6480464	Doxorubicin results in decreased expression of ZBTB20 mRNA	CTD	PMID:19277126
Zbtb20	Rat	doxorubicin	decreases expression	ISO	RGD:1351632	6480464	Doxorubicin results in decreased expression of ZBTB20 mRNA	CTD	PMID:29803840
Zbtb20	Rat	entinostat	decreases expression	ISO	RGD:1351632	6480464	entinostat results in decreased expression of ZBTB20 mRNA	CTD	PMID:26272509
Zbtb20	Rat	entinostat	multiple interactions	ISO	RGD:1351632	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Zbtb20	Rat	ethanol	multiple interactions	ISO	RGD:1351632	6480464	[Ethanol co-treated with Folic Acid] results in increased expression of ZBTB20 mRNA	CTD	PMID:23378141
Zbtb20	Rat	ethanol	increases expression	ISO	RGD:1557085	6480464	Ethanol results in increased expression of ZBTB20 mRNA	CTD	PMID:30319688
Zbtb20	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of ZBTB20 mRNA	CTD	PMID:30307764
Zbtb20	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of ZBTB20 mRNA	CTD	PMID:24136188
Zbtb20	Rat	folic acid	multiple interactions	ISO	RGD:1557085	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ...	CTD	PMID:20938992
Zbtb20	Rat	folic acid	decreases expression	ISO	RGD:1351632	6480464	Folic Acid results in decreased expression of ZBTB20 mRNA	CTD	PMID:21867686
Zbtb20	Rat	folic acid	multiple interactions	ISO	RGD:1351632	6480464	[Ethanol co-treated with Folic Acid] results in increased expression of ZBTB20 mRNA	CTD	PMID:23378141
Zbtb20	Rat	fulvestrant	multiple interactions	ISO	RGD:1351632	6480464	[bisphenol F co-treated with Fulvestrant] results in decreased methylation of ZBTB20 gene	CTD	PMID:31601247
Zbtb20	Rat	geraniol	increases expression	ISO	RGD:1351632	6480464	geraniol results in increased expression of ZBTB20 mRNA	CTD	PMID:27683099
Zbtb20	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of ZBTB20 mRNA	CTD	PMID:24136188
Zbtb20	Rat	glyphosate	decreases methylation	EXP		6480464	Glyphosate results in decreased methylation of ZBTB20 gene	CTD	PMID:31011160
Zbtb20	Rat	GSK-J4	increases expression	ISO	RGD:1351632	6480464	GSK-J4 results in increased expression of ZBTB20 mRNA	CTD	PMID:29301935
Zbtb20	Rat	hydroquinone O-beta-D-glucopyranoside	increases expression	ISO	RGD:1351632	6480464	Arbutin results in increased expression of ZBTB20 mRNA	CTD	PMID:17103032
Zbtb20	Rat	indometacin	multiple interactions	ISO	RGD:1351632	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Zbtb20	Rat	irinotecan	decreases expression	ISO	RGD:1351632	6480464	Irinotecan analog results in decreased expression of ZBTB20 mRNA	CTD	PMID:18927307
Zbtb20	Rat	L-methionine	multiple interactions	ISO	RGD:1557085	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ...	CTD	PMID:20938992
Zbtb20	Rat	melphalan	decreases expression	ISO	RGD:1351632	6480464	Melphalan results in decreased expression of ZBTB20 mRNA	CTD	PMID:22363485
Zbtb20	Rat	methidathion	increases expression	ISO	RGD:1557085	6480464	methidathion results in increased expression of ZBTB20 mRNA	CTD	PMID:34813904
Zbtb20	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of ZBTB20 mRNA	CTD	PMID:30047161
Zbtb20	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of ZBTB20 gene	CTD	PMID:35440735
Zbtb20	Rat	methyl methanesulfonate	increases expression	ISO	RGD:1351632	6480464	Methyl Methanesulfonate results in increased expression of ZBTB20 mRNA	CTD	PMID:23649840
Zbtb20	Rat	methylmercury chloride	increases expression	ISO	RGD:1351632	6480464	methylmercuric chloride results in increased expression of ZBTB20 mRNA	CTD	PMID:23179753
Zbtb20	Rat	methylmercury chloride	multiple interactions	ISO	RGD:1351632	6480464	[NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Zbtb20	Rat	methylmercury chloride	decreases expression	ISO	RGD:1351632	6480464	methylmercuric chloride results in decreased expression of ZBTB20 mRNA	CTD	PMID:26272509\|PMID:28001369
Zbtb20	Rat	nefazodone	decreases expression	EXP		6480464	nefazodone results in decreased expression of ZBTB20 mRNA	CTD	PMID:24136188
Zbtb20	Rat	nickel atom	decreases expression	ISO	RGD:1351632	6480464	Nickel results in decreased expression of ZBTB20 mRNA	CTD	PMID:24768652\|PMID:25583101
Zbtb20	Rat	ozone	multiple interactions	ISO	RGD:1557085	6480464	[Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ZBTB20 more ...	CTD	PMID:34911549
Zbtb20	Rat	ozone	multiple interactions	ISO	RGD:1351632	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of ZBTB20 mRNA	CTD	PMID:35430440
Zbtb20	Rat	paracetamol	affects expression	ISO	RGD:1557085	6480464	Acetaminophen affects the expression of ZBTB20 mRNA	CTD	PMID:17562736
Zbtb20	Rat	paracetamol	increases expression	ISO	RGD:1351632	6480464	Acetaminophen results in increased expression of ZBTB20 mRNA	CTD	PMID:26690555
Zbtb20	Rat	paracetamol	decreases expression	ISO	RGD:1351632	6480464	Acetaminophen results in decreased expression of ZBTB20 mRNA	CTD	PMID:21420995
Zbtb20	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of ZBTB20 mRNA	CTD	PMID:32680482
Zbtb20	Rat	PCB138	multiple interactions	ISO	RGD:1557085	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Zbtb20	Rat	perfluorooctane-1-sulfonic acid	decreases expression	ISO	RGD:1351632	6480464	perfluorooctane sulfonic acid results in decreased expression of ZBTB20 mRNA	CTD	PMID:27153767
Zbtb20	Rat	perfluorooctanoic acid	decreases expression	ISO	RGD:1351632	6480464	perfluorooctanoic acid results in decreased expression of ZBTB20 mRNA	CTD	PMID:25868421
Zbtb20	Rat	phenobarbital	affects expression	ISO	RGD:1557085	6480464	Phenobarbital affects the expression of ZBTB20 mRNA	CTD	PMID:23091169
Zbtb20	Rat	pirinixic acid	increases expression	ISO	RGD:1557085	6480464	pirinixic acid results in increased expression of ZBTB20 mRNA	CTD	PMID:16985257
Zbtb20	Rat	pirinixic acid	decreases expression	ISO	RGD:1557085	6480464	pirinixic acid results in decreased expression of ZBTB20 mRNA	CTD	PMID:23811191
Zbtb20	Rat	propiconazole	decreases expression	ISO	RGD:1557085	6480464	propiconazole results in decreased expression of ZBTB20 mRNA	CTD	PMID:21278054
Zbtb20	Rat	propiconazole	decreases expression	EXP		6480464	propiconazole results in decreased expression of ZBTB20 mRNA	CTD	PMID:30047161
Zbtb20	Rat	resorcinol	decreases expression	ISO	RGD:1351632	6480464	resorcinol results in decreased expression of ZBTB20 mRNA	CTD	PMID:22623647
Zbtb20	Rat	SB 431542	multiple interactions	ISO	RGD:1351632	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Zbtb20	Rat	sevoflurane	decreases methylation	ISO	RGD:1557085	6480464	Sevoflurane results in decreased methylation of ZBTB20 mRNA	CTD	PMID:35249202
Zbtb20	Rat	silicon dioxide	decreases expression	ISO	RGD:1351632	6480464	Silicon Dioxide analog results in decreased expression of ZBTB20 mRNA	CTD	PMID:23806026
Zbtb20	Rat	silver atom	increases expression	ISO	RGD:1351632	6480464	Silver results in increased expression of ZBTB20 mRNA	CTD	PMID:26014281
Zbtb20	Rat	silver(0)	increases expression	ISO	RGD:1351632	6480464	Silver results in increased expression of ZBTB20 mRNA	CTD	PMID:26014281
Zbtb20	Rat	sodium arsenate	increases expression	ISO	RGD:1557085	6480464	sodium arsenate results in increased expression of ZBTB20 mRNA	CTD	PMID:21795629
Zbtb20	Rat	sodium arsenate	decreases expression	ISO	RGD:1557085	6480464	sodium arsenate results in decreased expression of ZBTB20 mRNA	CTD	PMID:21795629
Zbtb20	Rat	sodium arsenite	increases expression	ISO	RGD:1351632	6480464	sodium arsenite results in increased expression of ZBTB20 mRNA	CTD	PMID:22714537\|PMID:38568856
Zbtb20	Rat	sodium arsenite	affects methylation	ISO	RGD:1351632	6480464	sodium arsenite affects the methylation of ZBTB20 gene	CTD	PMID:28589171
Zbtb20	Rat	styrene	decreases expression	ISO	RGD:1557085	6480464	Styrene results in decreased expression of ZBTB20 mRNA	CTD	PMID:28951217
Zbtb20	Rat	succimer	multiple interactions	ISO	RGD:1557085	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of ZBTB20 mRNA; [Succimer co-treated more ...	CTD	PMID:21641980\|PMID:26378955
Zbtb20	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of ZBTB20 mRNA	CTD	PMID:30047161
Zbtb20	Rat	sunitinib	increases expression	ISO	RGD:1351632	6480464	Sunitinib results in increased expression of ZBTB20 mRNA	CTD	PMID:31533062
Zbtb20	Rat	tetraphene	affects expression	ISO	RGD:1557085	6480464	benz(a)anthracene affects the expression of ZBTB20 mRNA	CTD	PMID:26377693
Zbtb20	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of ZBTB20 mRNA	CTD	PMID:23411599
Zbtb20	Rat	titanium dioxide	decreases expression	ISO	RGD:1557085	6480464	titanium dioxide results in decreased expression of ZBTB20 mRNA	CTD	PMID:27760801
Zbtb20	Rat	trichloroethene	increases expression	ISO	RGD:1557085	6480464	Trichloroethylene results in increased expression of ZBTB20 mRNA	CTD	PMID:19448997
Zbtb20	Rat	triphenyl phosphate	affects expression	ISO	RGD:1351632	6480464	triphenyl phosphate affects the expression of ZBTB20 mRNA	CTD	PMID:37042841
Zbtb20	Rat	triptonide	decreases expression	ISO	RGD:1557085	6480464	triptonide results in decreased expression of ZBTB20 mRNA	CTD	PMID:33045310
Zbtb20	Rat	troglitazone	decreases expression	ISO	RGD:1557085	6480464	troglitazone results in decreased expression of ZBTB20 mRNA	CTD	PMID:28973697
Zbtb20	Rat	valproic acid	affects expression	ISO	RGD:1351632	6480464	Valproic Acid affects the expression of ZBTB20 mRNA	CTD	PMID:25979313
Zbtb20	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of ZBTB20 mRNA	CTD	PMID:29427782
Zbtb20	Rat	valproic acid	multiple interactions	ISO	RGD:1351632	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Zbtb20	Rat	valproic acid	decreases expression	ISO	RGD:1351632	6480464	Valproic Acid results in decreased expression of ZBTB20 mRNA	CTD	PMID:23179753\|PMID:24935251\|PMID:26272509\|PMID:28001369
Zbtb20	Rat	vitamin E	decreases expression	ISO	RGD:1351632	6480464	Vitamin E results in decreased expression of ZBTB20 mRNA	CTD	PMID:19244175
Zbtb20	Rat	zinc atom	multiple interactions	ISO	RGD:1351632	6480464	[PCI 5002 co-treated with Zinc] results in increased expression of ZBTB20 mRNA	CTD	PMID:18593933
Zbtb20	Rat	zinc(0)	multiple interactions	ISO	RGD:1351632	6480464	[PCI 5002 co-treated with Zinc] results in increased expression of ZBTB20 mRNA	CTD	PMID:18593933

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	cellular response to glucose stimulus	involved_in	ISO	RGD:1557085	1624291	PMID:28327662	RGD	PMID:28327662
Zbtb20	Rat	cellular response to glucose stimulus	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	lipid homeostasis	involved_in	ISO	RGD:1557085	1624291	PMID:28327662	RGD	PMID:28327662
Zbtb20	Rat	lipid homeostasis	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	negative regulation of DNA-templated transcription	involved_in	ISO	RGD:1557085	1624291	PMID:23776228	RGD	PMID:23776228
Zbtb20	Rat	negative regulation of DNA-templated transcription	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	negative regulation of gene expression	involved_in	ISO	RGD:1557085	1624291	PMID:23776228	RGD	PMID:23776228
Zbtb20	Rat	negative regulation of gene expression	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:107187\|MGI:1195345\|MGI:1278332\|MGI:1929213\|PANTHER:PTN000578151\|UniProtKB:P41182\|UniProtKB:Q8N680\|UniProtKB:Q9Y2K1\|UniProtKB:Q9Y2Y4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Zbtb20	Rat	negative regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	negative regulation of transcription by RNA polymerase II	acts_upstream_of_or_within	ISO	RGD:1557085	1624291	MGI:3812013 PMID:18669658	RGD	PMID:18669658
Zbtb20	Rat	positive regulation of glycolytic process	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	positive regulation of glycolytic process	involved_in	ISO	RGD:1557085	1624291	PMID:28327662	RGD	PMID:28327662
Zbtb20	Rat	positive regulation of interferon-beta production	involved_in	ISO	RGD:1557085	1624291	PMID:23776228	RGD	PMID:23776228
Zbtb20	Rat	positive regulation of interferon-beta production	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	positive regulation of interleukin-6 production	involved_in	ISO	RGD:1557085	1624291	PMID:23776228	RGD	PMID:23776228
Zbtb20	Rat	positive regulation of interleukin-6 production	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	positive regulation of lipid biosynthetic process	involved_in	ISO	RGD:1557085	1624291	PMID:28327662	RGD	PMID:28327662
Zbtb20	Rat	positive regulation of lipid biosynthetic process	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	positive regulation of tumor necrosis factor production	involved_in	ISO	RGD:1557085	1624291	PMID:23776228	RGD	PMID:23776228
Zbtb20	Rat	positive regulation of tumor necrosis factor production	involved_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	regulation of cytokine production	involved_in	IBA	MGI:107187\|MGI:1891838\|MGI:1929213\|PANTHER:PTN000578151\|ZFIN:ZDB-GENE-030131-1989	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Zbtb20	Rat	regulation of immune system process	involved_in	IBA	MGI:107187\|MGI:2442326\|PANTHER:PTN000578151\|UniProtKB:P41182	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	cytoplasm	located_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	cytoplasm	located_in	ISO	RGD:1557085	1624291	PMID:28327662	RGD	PMID:28327662
Zbtb20	Rat	nuclear body	located_in	IEA	UniProtKB:Q9HC78\|ensembl:ENSP00000501561	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	nuclear body	located_in	ISO	RGD:1351632\|UniProtKB:Q9HC78-1\|UniProtKB:Q9HC78-2	1624291		RGD	GO_REF:0000052
Zbtb20	Rat	nucleoplasm	is_active_in	IBA	PANTHER:PTN002393396\|UniProtKB:O43829\|UniProtKB:P24278\|UniProtKB:P41182\|UniProtKB:P52739\|UniProtKB:Q15916\|UniProtKB:Q6ZSB9\|UniProtKB:Q86T24\|UniProtKB:Q96JB3\|UniProtKB:Q9HBE1\|UniProtKB:Q9HC78\|UniProtKB:Q9UM63\|UniProtKB:Q9Y2K1\|UniProtKB:Q9Y330	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Zbtb20	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q9HC78\|ensembl:ENSP00000501561	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	nucleoplasm	located_in	ISO	RGD:1351632\|UniProtKB:Q9HC78-1\|UniProtKB:Q9HC78-2	1624291		RGD	GO_REF:0000052
Zbtb20	Rat	nucleus	located_in	ISO	RGD:1557085	1624291	PMID:11744704, PMID:17301088, PMID:28327662	RGD	PMID:11744704\|PMID:17301088\|PMID:28327662
Zbtb20	Rat	nucleus	located_in	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Zbtb20	Rat	DNA binding	enables	ISO	RGD:1557085	1624291	PMID:11744704	RGD	PMID:11744704
Zbtb20	Rat	DNA binding	enables	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	IBA	MGI:107187\|MGI:1195345\|MGI:1278332\|MGI:1929213\|PANTHER:PTN002393396\|UniProtKB:P41182\|UniProtKB:Q8N680\|UniProtKB:Q9Y2Y4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Zbtb20	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	RGD:1557085	1624291	PMID:18669658	RGD	PMID:18669658
Zbtb20	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:107187\|MGI:1195345\|MGI:1891832\|PANTHER:PTN002393396\|UniProtKB:Q13105\|UniProtKB:Q8N680	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Zbtb20	Rat	sequence-specific double-stranded DNA binding	enables	ISO	RGD:1351632	1624291	PMID:28473536	RGD	PMID:28473536
Zbtb20	Rat	sequence-specific double-stranded DNA binding	enables	IEA	UniProtKB:Q9HC78\|ensembl:ENSP00000501561	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	transcription cis-regulatory region binding	enables	ISO	RGD:1557085	1624291	PMID:28327662	RGD	PMID:28327662
Zbtb20	Rat	transcription cis-regulatory region binding	enables	IEA	UniProtKB:Q8K0L9\|ensembl:ENSMUSP00000110342	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Zbtb20	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

COVID-19 (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Marfanoid Mental Retardation Syndrome, Autosomal (ISO)

Neurodevelopmental Disorders (ISO)

pre-malignant neoplasm (ISO)

Primrose Syndrome (ISO)

Prostatic Neoplasms (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

bilirubin IXalpha (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

buspirone (EXP)

butanal (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloroprene (EXP)

choline (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

daunorubicin (ISO)

DDT (EXP)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

finasteride (EXP)

folic acid (ISO)

fulvestrant (ISO)

geraniol (ISO)

glafenine (EXP)

glyphosate (EXP)

GSK-J4 (ISO)

hydroquinone O-beta-D-glucopyranoside (ISO)

indometacin (ISO)

irinotecan (ISO)

L-methionine (ISO)

melphalan (ISO)

methidathion (ISO)

methimazole (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nefazodone (EXP)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

propiconazole (EXP,ISO)

resorcinol (ISO)

SB 431542 (ISO)

sevoflurane (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

styrene (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetraphene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

troglitazone (ISO)

valproic acid (EXP,ISO)

vitamin E (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to glucose stimulus (IEA,ISO)

lipid homeostasis (IEA,ISO)

negative regulation of DNA-templated transcription (IEA,ISO)

negative regulation of gene expression (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

positive regulation of glycolytic process (IEA,ISO)

positive regulation of interferon-beta production (IEA,ISO)

positive regulation of interleukin-6 production (IEA,ISO)

positive regulation of lipid biosynthetic process (IEA,ISO)

positive regulation of tumor necrosis factor production (IEA,ISO)

regulation of cytokine production (IBA)

regulation of immune system process (IBA)

Cellular Component

cytoplasm (IEA,ISO)

nuclear body (IEA,ISO)

nucleoplasm (IBA,IEA,ISO)

nucleus (IEA,ISO)

Molecular Function

DNA binding (IEA,ISO)

DNA-binding transcription repressor activity, RNA polymerase II-specific (IBA,IEA,ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

transcription cis-regulatory region binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11744704	PMID:17301088	PMID:18669658	PMID:22082260	PMID:23776228	PMID:28327662	PMID:30281617	PMID:31505169	PMID:38009899

Genomics

Comparative Map Data

Zbtb20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	70,558,010 - 71,297,039 (-)	NCBI		GRCr8
mRatBN7.2	11	57,052,129 - 57,791,214 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	57,072,880 - 57,510,210 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	65,865,277 - 66,604,324 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	58,527,515 - 59,266,582 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	57,583,947 - 58,333,500 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	62,014,925 - 62,561,113 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	62,014,925 - 62,451,184 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	61,127,464 - 61,865,305 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	58,662,837 - 59,399,213 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	56,625,650 - 57,340,896 (-)	NCBI		Celera
Cytogenetic Map	11	q21	NCBI

ZBTB20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	114,314,500 - 115,147,288 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	114,314,500 - 115,147,292 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	114,033,347 - 114,866,135 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	115,540,207 - 116,348,817 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	115,540,214 - 116,348,817	NCBI
Celera	3	112,464,305 - 113,273,740 (-)	NCBI		Celera
Cytogenetic Map	3	q13.31	NCBI
HuRef	3	111,429,714 - 112,238,947 (-)	NCBI		HuRef
CHM1_1	3	114,019,853 - 114,829,143 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	117,035,293 - 117,867,765 (-)	NCBI		T2T-CHM13v2.0

Zbtb20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	42,728,008 - 43,462,981 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	42,696,244 - 43,462,965 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	42,875,689 - 43,634,392 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	42,875,881 - 43,642,602 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	43,247,397 - 43,619,241 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	43,429,640 - 43,538,402 (+)	NCBI		MGSCv36	mm8
Celera	16	43,602,896 - 43,973,689 (+)	NCBI		Celera
Cytogenetic Map	16	B4	NCBI
cM Map	16	28.44	NCBI

Zbtb20
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	14,409,700 - 14,453,926 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955427	14,409,700 - 15,231,495 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZBTB20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	112,299,158 - 113,129,391 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	112,303,936 - 113,134,146 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	111,445,520 - 112,275,946 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	118,365,142 - 118,806,716 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	118,389,250 - 118,431,453 (-)	Ensembl	panpan1.1		panPan2

ZBTB20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	18,860,824 - 19,277,691 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	18,529,132 - 18,759,058 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	18,969,248 - 19,387,126 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	18,774,605 - 19,529,023 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	18,773,579 - 19,528,961 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	18,915,382 - 19,333,223 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	18,961,846 - 19,380,040 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	19,174,504 - 19,925,316 (-)	NCBI		UU_Cfam_GSD_1.0

Zbtb20
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	134,975,624 - 135,767,604 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936536	1,776,081 - 1,829,837 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936536	1,776,065 - 2,546,286 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZBTB20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	145,591,894 - 145,644,880 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	144,855,821 - 145,668,320 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

ZBTB20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	65,715,470 - 66,528,195 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	66,511,237 - 66,524,064 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	99,934,836 - 100,649,336 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Zbtb20
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	34,108,927 - 34,172,231 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	33,307,686 - 34,202,576 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Zbtb20
1993 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	443
Count of miRNA genes:	228
Interacting mature miRNAs:	296
Transcripts:	ENSRNOT00000002692
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat

Markers in Region

D11Got47

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,615,452 - 57,615,671 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,556,663 - 62,556,883	NCBI	Rnor6.0
Rnor_5.0	11	61,689,504 - 61,689,724	UniSTS	Rnor5.0
RGSC_v3.4	11	59,220,404 - 59,220,625	RGD	RGSC3.4
RGSC_v3.4	11	59,220,405 - 59,220,625	UniSTS	RGSC3.4
RGSC_v3.1	11	59,277,994 - 59,278,214	RGD
Celera	11	57,166,394 - 57,166,614	UniSTS
RH 3.4 Map	11	512.6	UniSTS
RH 3.4 Map	11	512.6	RGD
RH 2.0 Map	11	207.7	RGD
Cytogenetic Map	11	q21	UniSTS

D11Got49

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,615,444 - 57,615,683 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,556,655 - 62,556,895	NCBI	Rnor6.0
Rnor_5.0	11	61,689,496 - 61,689,736	UniSTS	Rnor5.0
RGSC_v3.4	11	59,220,396 - 59,220,638	RGD	RGSC3.4
RGSC_v3.4	11	59,220,397 - 59,220,637	UniSTS	RGSC3.4
RGSC_v3.1	11	59,277,985 - 59,278,227	RGD
Celera	11	57,166,386 - 57,166,626	UniSTS
RH 3.4 Map	11	513.1	RGD
RH 3.4 Map	11	513.1	UniSTS
Cytogenetic Map	11	q21	UniSTS

D11Got109

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,433,867 - 57,434,075 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,375,769 - 62,375,974	NCBI	Rnor6.0
Rnor_5.0	11	61,508,610 - 61,508,815	UniSTS	Rnor5.0
RGSC_v3.4	11	59,038,711 - 59,038,916	UniSTS	RGSC3.4
Celera	11	56,985,616 - 56,985,821	UniSTS
Cytogenetic Map	11	q21	UniSTS

D16Mit40

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,702,900 - 57,703,140 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,618,781 - 57,619,020	NCBI	Rnor6.0
Rnor_5.0	11	61,776,247 - 61,776,486	UniSTS	Rnor5.0
RGSC_v3.4	11	59,309,732 - 59,309,971	UniSTS	RGSC3.4
Celera	11	57,253,207 - 57,253,446	UniSTS
Cytogenetic Map	11	q21	UniSTS

BF400664

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	11	70,852,300 - 70,852,476 (+)	Marker Load Pipeline
mRatBN7.2	11	57,346,447 - 57,346,623 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,288,367 - 62,288,542	NCBI	Rnor6.0
Rnor_5.0	11	61,421,087 - 61,421,262	UniSTS	Rnor5.0
RGSC_v3.4	11	58,940,594 - 58,940,769	UniSTS	RGSC3.4
Celera	11	56,898,275 - 56,898,450	UniSTS
RH 3.4 Map	11	546.92	UniSTS
Cytogenetic Map	11	q21	UniSTS

BF419565

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,178,654 - 57,178,786 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,120,650 - 62,120,781	NCBI	Rnor6.0
Rnor_5.0	11	61,253,620 - 61,253,751	UniSTS	Rnor5.0
RGSC_v3.4	11	58,771,190 - 58,771,321	UniSTS	RGSC3.4
Celera	11	56,731,417 - 56,731,548	UniSTS
RH 3.4 Map	11	546.92	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH138206

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,119,018 - 57,119,218 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,061,018 - 62,061,217	NCBI	Rnor6.0
Rnor_5.0	11	61,194,089 - 61,194,288	UniSTS	Rnor5.0
RGSC_v3.4	11	58,709,395 - 58,709,594	UniSTS	RGSC3.4
Celera	11	56,671,766 - 56,671,965	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH138427

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,073,865 - 57,074,040 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,015,911 - 62,016,085	NCBI	Rnor6.0
Rnor_5.0	11	61,148,982 - 61,149,156	UniSTS	Rnor5.0
RGSC_v3.4	11	58,663,823 - 58,663,997	UniSTS	RGSC3.4
Celera	11	56,626,636 - 56,626,810	UniSTS
RH 3.4 Map	4	1028.2	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH139605

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,073,363 - 57,073,555 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,015,409 - 62,015,600	NCBI	Rnor6.0
Rnor_5.0	11	61,148,480 - 61,148,671	UniSTS	Rnor5.0
RGSC_v3.4	11	58,663,321 - 58,663,512	UniSTS	RGSC3.4
Celera	11	56,626,134 - 56,626,325	UniSTS
Cytogenetic Map	11	q21	UniSTS

RH140468

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,073,363 - 57,073,491 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,015,409 - 62,015,536	NCBI	Rnor6.0
Rnor_5.0	11	61,148,480 - 61,148,607	UniSTS	Rnor5.0
RGSC_v3.4	11	58,663,321 - 58,663,448	UniSTS	RGSC3.4
Celera	11	56,626,134 - 56,626,261	UniSTS
Cytogenetic Map	11	q21	UniSTS

AU049731

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,776,874 - 57,777,139 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	57,693,306 - 57,693,570	NCBI	Rnor6.0
Rnor_5.0	11	61,850,847 - 61,851,111	UniSTS	Rnor5.0
RGSC_v3.4	11	59,384,874 - 59,385,138	UniSTS	RGSC3.4
Celera	11	57,326,559 - 57,326,823	UniSTS
Cytogenetic Map	11	q21	UniSTS

Zbtb20

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,084,533 - 57,085,345 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,026,579 - 62,027,390	NCBI	Rnor6.0
Rnor_5.0	11	61,159,650 - 61,160,461	UniSTS	Rnor5.0
RGSC_v3.4	11	58,674,920 - 58,675,731	UniSTS	RGSC3.4
Celera	11	56,637,304 - 56,638,115	UniSTS
Cytogenetic Map	11	q21	UniSTS

ZBTB20_9462

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,075,429 - 57,076,381 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,017,475 - 62,018,426	NCBI	Rnor6.0
Rnor_5.0	11	61,150,546 - 61,151,497	UniSTS	Rnor5.0
RGSC_v3.4	11	58,665,387 - 58,666,338	UniSTS	RGSC3.4
Celera	11	56,628,200 - 56,629,151	UniSTS
Cytogenetic Map	11	q21	UniSTS

STS-Z40707

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	57,295,345 - 57,295,800 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	62,237,168 - 62,237,622	NCBI	Rnor6.0
Rnor_5.0	11	61,369,888 - 61,370,342	UniSTS	Rnor5.0
RGSC_v3.4	11	58,888,671 - 58,889,125	UniSTS	RGSC3.4
RGSC_v3.4	12	25,076,071 - 25,077,759	UniSTS	RGSC3.4
Celera	11	56,847,170 - 56,847,624	UniSTS
Cytogenetic Map	11	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105880	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216395	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000081443 ⟹ ENSRNOP00000072458

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	57,072,880 - 57,510,210 (-)	Ensembl
Rnor_6.0 Ensembl	11	62,014,925 - 62,451,184 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093141 ⟹ ENSRNOP00000076280

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	57,084,763 - 57,328,562 (-)	Ensembl
Rnor_6.0 Ensembl	11	62,017,717 - 62,128,044 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093179 ⟹ ENSRNOP00000076193

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	62,017,745 - 62,396,967 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093382 ⟹ ENSRNOP00000076135

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	62,017,705 - 62,067,655 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093596 ⟹ ENSRNOP00000076312

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	62,017,758 - 62,396,909 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000093686 ⟹ ENSRNOP00000076181

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	62,027,571 - 62,451,149 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119899 ⟹ ENSRNOP00000091721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	57,072,880 - 57,090,559 (-)	Ensembl

RefSeq Acc Id:

NM_001105880 ⟹ NP_001099350

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	70,558,010 - 71,297,039 (-)	NCBI
mRatBN7.2	11	57,052,129 - 57,791,214 (-)	NCBI
Rnor_6.0	11	62,014,925 - 62,561,113 (-)	NCBI
Rnor_5.0	11	61,127,464 - 61,865,305 (-)	NCBI
RGSC_v3.4	11	58,662,837 - 59,399,213 (-)	RGD
Celera	11	56,625,650 - 57,340,896 (-)	RGD

Sequence:

show sequence

GGCAGTCATTACCACTCACACTGTACTTCCAGGGAGACACCGGTTATGAGAAGAGAGACTCAGC
GCTGGGGAAGAAGATAAATGAATGGAGTGTTTGAATTGCCCTTTGCAACTCTGAAGACTGAAGA
GTTCCTGATGAATTGCATGTCTGTTTGTGCCTCATAGCCGCACAGGGATGACTGTTTGATATTG
GAAAACCAGTTGGTGTGCTCTTTCCTGACTGCCTGAAGTTACATTTCAAGAGCAAAATCACTGC
ACCTTAAAAACAAAAGATTGGGCTGCACTGTGTTCCTACTGTTTCATCATCAGCAATTGAGTAT
TTCATACAGCCTTGCTGACTGTTCCTTGACCACCAGTCTGTTGCCTGTTTCTGCTCTTCATATG
CAGCCACTCTCTGTCCCCTGCCCCAATGAACATCTGCACTAGGCCCAAGCCTTGGAGTGATTTA
CTGAAGAGTAACGCCAATTATCTGGAAACTACTAAAGTATTGAGGACCAGGGTAAAGGAAATGC
TAATGTAGAGGGGAAGCAATGAGGAAACTGAAGCCCAGAGAGGTGAAGTGAGGTGCCCAAAGCC
ACACAGCAAGTTGCAGGCACAGCTAGTCCCGTAGCTCAAGGCTCCTGACTCCCAGTCCAGTGCT
CTTCCCATTACTCCACGGGTCCTGACTCTAAGCTTCCTGACAAATGCTAGAACGGAAGAAACCC
AAGACAGCTGAAAACCAGAAGGCATCTGAGGAGAATGAGATTACTCAGCCGGGTGGATCCAGCG
CCAAGCCGGGCCTTCCCTGCCTGAACTTTGAAGCTGTTTTGTCTCCAGACCCAGCCCTCATCCA
CTCAACACATTCACTGACAAACTCTCACGCTCACACCGGGTCATCTGATTGTGACATCAGTTGC
AAGGGGATGACCGAGCGCATTCACAGCATCAACCTTCACAACTTCAGCAATTCCGTGCTCGAGA
CCCTCAACGAGCAGCGCAACCGTGGCCACTTCTGTGACGTGACGGTTCGCATCCACGGGAGCAT
GCTGCGCGCACATCGCTGCGTGCTGGCAGCCGGCAGCCCCTTCTTCCAAGACAAGCTGCTGCTG
GGCTACAGCGACATCGAAATCCCGTCCGTGGTGTCCGTACAGTCAGTGCAAAAGCTCATTGACT
TCATGTACAGCGGTGTGCTGAGAGTCTCCCAGTCGGAAGCTCTGCAGATCCTCACAGCCGCCAG
CATCCTGCAGATCAAAACAGTCATAGATGAGTGCACACGCATCGTGTCACAAAATGTGGGCGAT
GTGTTCCCAGGCATCCAGGATTCTGGCCAGGACACACCGAGAGGCACACCAGAGTCAGGCACAT
CCGGCCAGAGCAGTGACACAGAATCAGGCTACCTGCAAAGCCACCCACAGCACAGTGTGGACCG
AATCTACTCTGCACTCTACGCATGCTCCATGCAGAATGGCAGTGGTGAGCGCTCCTTCTACAGC
GGTGCAGTGGTCAGCCACCACGAAACTGCTCTGGGCCTGCCCCGTGACCACCACATGGAAGACC
CCAGCTGGATTACACGCATCCATGAGCGCTCCCAGCAAATGGAGCGCTACCTGTCCACCACCCC
TGAGACCACGCACTGCCGCAAGCAGCCCCGGCCTGTGCGCATCCAGACCCTGGTGGGTAATATC
CACATCAAGCAGGAAATGGAGGATGACTATGACTACTATGGGCAGCAAAGGGTGCAGATCCTAG
AGCGCAATGAATCTGAGGAGTGCACAGAAGATACTGACCAGGCAGAGGGCACAGAGAGCGAGCC
CAAAGGTGAAAGCTTCGATTCTGGAGTCAGCTCCTCTATTGGCACCGAACCTGACTCAGTGGAG
CAACAGTTTGGGGCGGGAGCCACGAGAGAGGGTCAGGTGGAAGCTGCCCAGCCCGAGCAGGCAG
CAGAAGCCCCAGCTGAGAGCAGTGCCCAGCCAAACCAGCTAGAAACAGGTGCCTCCTCTCCCGA
GAGAAGCACCGAGGTAGAGATGGACAACACAGTCATCACTGTCAGTAACAGCTCCGATAAGGGC
GTCCTACAGCAGCCTTCAGTCAACACATCAATCGGGCAGCCATTGCCAAGTACCCAGCTCTATT
TACGCCAGACAGAAACCCTCACCAGCAACCTGAGGATGCCTCTGACCTTGACCAGCAACACACA
GGTCATTGGCACAGCTGGCAACACCTATCTGCCAGCCCTCTTCACTACCCAGCCCGCGGGCAGT
GGCCCCAAGCCTTTTCTTTTCAGCCTGCCACAGCCCCTGACAGGCCAGCAGACCCAGTTTGTGA
CAGTGTCCCAGCCAGGCCTGTCCACCTTTACTGCACAGCTGCCAGCGCCACAGCCCCTGGCCTC
ATCTGCAAGCCACAGCACAGCCAGTGGGCAAGGTGACAAAAAGCCTTATGAGTGCACTCTCTGC
AACAAGACTTTCACAGCCAAACAGAACTACGTCAAGCACATGTTCGTACATACAGGTGAGAAGC
CCCACCAGTGCAGCATCTGTTGGCGCTCCTTCTCCTTGAAGGATTACCTTATCAAGCACATGGT
GACACACACAGGAGTGAGAGCATACCAGTGTAGCATCTGCAACAAGCGCTTCACCCAGAAGAGT
TCCCTCAATGTGCACATGCGCCTGCACCGCGGGGAGAAGTCCTATGAGTGCTACATCTGCAAAA
AGAAGTTCTCCCACAAGACCCTGCTGGAGCGACATGTGGCCCTGCACAGCGCCAGCAACGGGAC
CCCTCCAGCAGGCACACCCCCAGGTGCCCGCGCGGGTCCGCCAGGCGTGGTGGCCTGCACAGAG
GGGACCACTTACGTCTGCTCCGTCTGCCCAGCAAAGTTTGACCAAATCGAGCAGTTCAACGACC
ACATGAGGATGCATGTGTCTGACGGATAAGTAGTACCTTTCTCTCTTTCTTATGAACCAAACAA
AACAACAACAAAAGAAATAAACAAACAAACAGACAGACAACAAGCTATGGCACTAGAATTTAAG
AAATGTTTTGGTTTCATTTTTACTTTCTGTTTTTGTTTTTGTTCCGTTTCATTTTGTACTACAT
GAAGAACTGTTTTTTGCCTGCTGGTACATTACATTTCCGGGGGCTTGGGTGGATAATACTTTTC
CCAGTCTCCCTTGGATGGTGGCCTTAAGGCCTGGTAGTGCTTCAAGAGGTCCACTGGTTGGATC
TCTAGCTACTGGCCTCTAAATACAACCCTTCTTTACAAAAACAAAAAAAAACAAACAAACAAAA
AAAAACAAAAACAAAACAAAAAAATAAAACAAAAAAAGCAAAAAACCACACACACACACAAAAA
ACAAAAAAATCTTTTAAAAAAGTTTTAAAAAATGTTTAAAAAAGAAAAATTGTTTTTCCACTCG
TGAAGAGCACTACAAAATTTATTACGAGATGTAAAGGCCTGCTGTCTTTAAGTACACCGCTCAC
AGTGTTTCAGTGGACATTTCACAATTCTGGCCACTTGGACTTCACAGTAAGCAGTTTAAACTGT
GGAATATCACTTCTGGTTGAAAACCCAGAGGAAAGGCCCTGCTGTTTCCACCTACTGCGTTGTC
TGATTTCACTAAAGGGCTCTGGGATGGGATGGGGCGGGGAGCCAGGTGTGAGGGAAACTGTGTG
GCAGGCTTCTCCCCCAGACCCGCCTGGTCCACACACCCTGGCCCACCTCCTCCGCATCCCCGCC
CCTTTCAGCAGAACCAGGAAGACTTGGATGAGCAGCAAGCAACAGTGGCCATCGTATTTATTCA
GTGTCTTTGCTGAGCCCCGGCCTCAGCACAATCCAGAGGGACTTTCATGAAAGGCAGGAATGCA
GATAAAACAAAGATTACAGATTTGCACCTATGTTTCTAGGTACAAGAGAAGGATTATTTCCAAC
AATCTTTGCAAAAAAAAAAAGTGTCAGGATATATTCTTGTGGAAGAGAAAAGGAAAGAGAAATG
GAGGGTGGGGGGAACCGTAAAAGTTCTTGAGGCTTTTTTAATTCAAAAATTTATAGAGGGGCAA
AAGTGATGTTTACCAGATAGAATGCTGATTTTTTTAATATATTTACAACAGTATTTGTGTAAAA
AAAAAACAAAAAAGTGAGATTGTTAAAGTGATTTTTTTTTCTCGTTTTGTTCTGCATACACTGC
CACCGCCCCCTTCTTTTACTTTGTCTCACACACATATATATATTTTTTGGTAAGTCAAGACTGT
TAAGGTTAGCGATACTGCTTCCAGATAGAAAGAATAAAAGGCAACTAAAGCTATATTTGAAAGA
GAGGAAGGATATTTTCTTCATATTTTTTCTTAGTTTTTATTATTTTAAAGTATTGCCTGGGTTG
CTGAGGGCCTCCGAGGCCCGCCCGCCCTGCTGTAATTTCGACTGCTGCTCTGTTTTGATGCGTA
GATCTTTGACTTGTAGCAAGCTTAAGGGGCTCCACTGAGTATCACCGTCCGTCTAGAATTCTGT
CCTTTGTCACGGGAGGGAAGTGCTCTTTTAGAAGCAGGTTTCTTACTTCTCCATCGTCTCACTG
AGCTCTTAGGATTCTAGAGTTTCCATTAACCTTGCTTTTTCCTATGGTGAAACACTAGTGGTCT
AGAGATCTTGACTAGGGGTTCATTTCCTTTATGATCCGCCAGGAGAAGGAATCCACATGCCTCT
ACCCTGCTCCTCACCTCTCCACTGTGTGAGCATCACTACGAGAAGCCTGTTACAAGCCACAGTG
CATTGATGCCAAAACTCCTTTCTCCTTTCACAGCCTCTGACTCTCTCCATCATGGCTGACAGGG
CTGAGTAGGATGATCATTCTTTAGTTGATTGTTGACCCTTTTATTTTATTTTATTTTATTTTAT
TTTATTTTTTGGAAATTAACAGTTTCTCTATGCTAACATCCAGCTTTCAGAAGGCCAGGAATCT
CCAGCATCATCCCAGATGCCGCCCTTTCTAGTTGGGGTTTCTCTCTTTGGTCTTGATCAAGAAA
TCATAAGATTTTCCAGTTATATACAATGTCCTAAAGGGATTCCAACTAAAAAAAATAGGACTTT
TTAAACCTAGCTAATACTTGCTAAGTAATTTCATGACTGGCCATGTTTTAGCATACTTAAAAGG
AAAAATAACTATTTCAACAATATAAAAACACAAAACTACATTTTTTTTTAGAAAGAAGAAAGGG
TATTTTCTTTTCTAAATTGTTCTACATTTTAATTCAATTTTCCTCTGAATTTTCCTGTTAGCGT
TTTATTTACAAAAAAAGGAAAAAAATGCAGCAAATGAGGGGAAATTTTCCAAGGCAAGCAACTC
TATAATGACTAAATTGGTTTTATTAATATATTTTAGACAACTGGTTGACTTGGATCTTTCCATA
AGTTCTTTGTGATGTTTAGTAGTTTGTGCAGCTGGAGTATTTGTGGCGTTGAAGTTGGTCTTAT
GGTGCTTAATTCAGTGGATGTTTTGCTAGAAGTTGTAGTGTGGATTTGGATGGGTAACTGACTA
CTGAGTATCACTTATCGTGATGACTGAGAAGAGGACACCCAAGAACTTGTGTGACCTGTTTTAA
AAATTAGCTTCAGAAACGCAGAAGTTCTCCCTACCCTACGTCCTGCTGTTTTTGCTGTTGTTAA
TATTCCAAGTCAGGAGTGACTTAATGTTTCTTTACCACCAATAGAGGGAGCATTAAGTAATGAC
GTCATGGAGTCATTTGTATAGTTCAAAAAATCTGAGTCCTTTAACCCATCAGGAAAAAAAGAAG
GAACGCTGTGATTATTTTTTTCTTAATCTGGAGGGGAAAAGACATGAAATCACTCATCGTATAA
AGCAAGTAAAAGAAAGCCAAGGCCCAGTTTCAGTTATCTTCACTGTTGATGGGAGAACATTCAA
AGTAGTGTCTCTAGTCAAACTTCAGTAAAGTAGTCAGAAGTCAGACTGTTCCTGGGAAGACTTA
AGTCTTGCGTGCCATTAGGTTACACTTCGATCTGCTATGACGTCTGAAAGAGTCCCATTTGTCT
TAATGCTGATTTTTCCATTGTCAAAAAGCTAAGCAACTGGGTTCAAAATCTAGTATTTATTGTA
AAGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099350	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11178	(Get FASTA)	NCBI Sequence Viewer
	EDM11179	(Get FASTA)	NCBI Sequence Viewer
	EDM11180	(Get FASTA)	NCBI Sequence Viewer
	EDM11181	(Get FASTA)	NCBI Sequence Viewer
	EDM11182	(Get FASTA)	NCBI Sequence Viewer
	EDM11183	(Get FASTA)	NCBI Sequence Viewer
	EDM11184	(Get FASTA)	NCBI Sequence Viewer
	EDM11185	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072458.2
	ENSRNOP00000076280
	ENSRNOP00000076280.2
	ENSRNOP00000091721.1

RefSeq Acc Id:

NP_001099350 ⟸ NM_001105880

- UniProtKB:

A0A1W2Q655 (UniProtKB/TrEMBL), D4A1U1 (UniProtKB/TrEMBL), A6IR28 (UniProtKB/TrEMBL), A6IR32 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRCVLAAGSPFFQDKLLLGY
SDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASILQIKTVIDECTRIVSQNVGDVF
PGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSVDRIYSALYACSMQNGSGERSFYSGA
VVSHHETALGLPRDHHMEDPSWITRIHERSQQMERYLSTTPETTHCRKQPRPVRIQTLVGNIHI
KQEMEDDYDYYGQQRVQILERNESEECTEDTDQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQ
FGAGATREGQVEAAQPEQAAEAPAESSAQPNQLETGASSPERSTEVEMDNTVITVSNSSDKGVL
QQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGP
KPFLFSLPQPLTGQQTQFVTVSQPGLSTFTAQLPAPQPLASSASHSTASGQGDKKPYECTLCNK
TFTAKQNYVKHMFVHTGEKPHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSL
NVHMRLHRGEKSYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGARAGPPGVVACTEGT
TYVCSVCPAKFDQIEQFNDHMRMHVSDG

hide sequence

Ensembl Acc Id:

ENSRNOP00000076312 ⟸ ENSRNOT00000093596

Ensembl Acc Id:

ENSRNOP00000076181 ⟸ ENSRNOT00000093686

Ensembl Acc Id:

ENSRNOP00000076135 ⟸ ENSRNOT00000093382

Ensembl Acc Id:

ENSRNOP00000072458 ⟸ ENSRNOT00000081443

Ensembl Acc Id:

ENSRNOP00000076193 ⟸ ENSRNOT00000093179

Ensembl Acc Id:

ENSRNOP00000076280 ⟸ ENSRNOT00000093141

Ensembl Acc Id:

ENSRNOP00000091721 ⟸ ENSRNOT00000119899

Protein Domains

BTB C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A1W2Q655-F1-model_v2	AlphaFold	A0A1W2Q655	1-741	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698159

Promoter ID:

EPDNEW_R8681

Type:

multiple initiation site

Name:

Zbtb20_1

Description:

zinc finger and BTB domain containing 20

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	62,396,967 - 62,397,027	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560387	AgrOrtholog
BioCyc Gene	G2FUF-21327	BioCyc
Ensembl Genes	ENSRNOG00000056716	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000081443.2	UniProtKB/TrEMBL
	ENSRNOT00000093141	ENTREZGENE
	ENSRNOT00000093141.2	UniProtKB/TrEMBL
	ENSRNOT00000119899.1	UniProtKB/TrEMBL
Gene3D-CATH	Classic Zinc Finger	UniProtKB/TrEMBL
	Potassium Channel Kv1.1, Chain A	UniProtKB/TrEMBL
InterPro	BTB/POZ-like	UniProtKB/TrEMBL
	BTB/POZ_fold	UniProtKB/TrEMBL
	Znf_C2H2/integrase_DNA-bd	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
	ZnFinger_BTB_dom_contain	UniProtKB/TrEMBL
KEGG Report	rno:288105	UniProtKB/TrEMBL
NCBI Gene	288105	ENTREZGENE
PANTHER	AGAP004733-PA	UniProtKB/TrEMBL
	ZINC FINGER AND BTB DOMAIN CONTAINING 45	UniProtKB/TrEMBL
Pfam	BTB	UniProtKB/TrEMBL
	zf-C2H2	UniProtKB/TrEMBL
PhenoGen	Zbtb20	PhenoGen
PROSITE	BTB	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000056716	RatGTEx
SMART	BTB	UniProtKB/TrEMBL
	ZnF_C2H2	UniProtKB/TrEMBL
Superfamily-SCOP	BTB/POZ_fold	UniProtKB/TrEMBL
	SSF57667	UniProtKB/TrEMBL
UniProt	A0A1W2Q655	ENTREZGENE
	A0A1W2Q6H7_RAT	UniProtKB/TrEMBL
	A0A8I6AG19_RAT	UniProtKB/TrEMBL
	A6IR28	ENTREZGENE, UniProtKB/TrEMBL
	A6IR32	ENTREZGENE, UniProtKB/TrEMBL
	D4A1U1	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A1W2Q655	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Zbtb20	zinc finger and BTB domain containing 20	Zbtb20_predicted	zinc finger and BTB domain containing 20 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Zbtb20_predicted	zinc finger and BTB domain containing 20 (predicted)	RGD1560387_predicted	similar to Zbtb20 protein (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1560387_predicted	similar to Zbtb20 protein (predicted)	LOC288105	similar to Zbtb20 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC288105	similar to Zbtb20 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM