Map6d1 (MAP6 domain containing 1)

Advanced Search (OLGA)

Gene: Map6d1 (MAP6 domain containing 1) Rattus norvegicus

Analyze

Symbol:

Map6d1

Name:

MAP6 domain containing 1

RGD ID:

1560102

Description:

Predicted to enable calmodulin binding activity and microtubule binding activity. Predicted to be involved in cytoskeleton-dependent intracellular transport and regulation of microtubule cytoskeleton organization. Predicted to act upstream of or within N-terminal peptidyl-L-cysteine N-palmitoylation and negative regulation of microtubule depolymerization. Predicted to be active in Golgi-associated vesicle; cis-Golgi network; and microtubule. Orthologous to human MAP6D1 (MAP6 domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC363823; MAP6 domain-containing protein 1; RGD1560102; similar to hypothetical protein FLJ12748

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MAP6D1 (MAP6 domain containing 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Map6d1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MAP6D1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MAP6D1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Map6d1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MAP6D1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MAP6D1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Map6d1 (MAP6 domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MAP6D1 (MAP6 domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Map6d1 (MAP6 domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	map6d1 (MAP6 domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	94,238,552 - 94,244,781 (+)	NCBI		GRCr8
mRatBN7.2	11	80,734,148 - 80,740,377 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	80,734,148 - 80,740,377 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	89,453,328 - 89,459,677 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	82,106,664 - 82,113,013 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	81,167,807 - 81,174,156 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	84,321,078 - 84,327,307 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	84,321,078 - 84,327,307 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	87,385,908 - 87,392,137 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	82,981,697 - 82,987,926 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	79,569,527 - 79,575,756 (+)	NCBI		Celera
Cytogenetic Map	11	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-methylcrotonyl-CoA carboxylase 1 deficiency (ISO)

congenital disorder of glycosylation Id (ISO)

Currarino syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

Brodifacoum (EXP)

butanal (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

dibutyl phthalate (EXP)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

fulvestrant (ISO)

hydrogen peroxide (ISO)

lead diacetate (ISO)

lead(0) (ISO)

methapyrilene (ISO)

methyl methanesulfonate (ISO)

pentanal (ISO)

silicon dioxide (ISO)

sunitinib (ISO)

temozolomide (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoskeleton-dependent intracellular transport (IBA)

microtubule cytoskeleton organization (IEA)

N-terminal peptidyl-L-cysteine N-palmitoylation (ISO)

negative regulation of microtubule depolymerization (ISO)

regulation of microtubule cytoskeleton organization (IBA)

Cellular Component

cis-Golgi network (IBA,ISO)

Golgi-associated vesicle (IBA,ISO)

microtubule (IBA)

Molecular Function

calmodulin binding (ISO)

microtubule binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16837464	PMID:22871113

Genomics

Comparative Map Data

Map6d1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	94,238,552 - 94,244,781 (+)	NCBI		GRCr8
mRatBN7.2	11	80,734,148 - 80,740,377 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	80,734,148 - 80,740,377 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	89,453,328 - 89,459,677 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	82,106,664 - 82,113,013 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	81,167,807 - 81,174,156 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	84,321,078 - 84,327,307 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	84,321,078 - 84,327,307 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	87,385,908 - 87,392,137 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	82,981,697 - 82,987,926 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	79,569,527 - 79,575,756 (+)	NCBI		Celera
Cytogenetic Map	11	q23	NCBI

MAP6D1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	183,815,922 - 183,825,577 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	183,815,922 - 183,825,594 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	183,533,710 - 183,543,365 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	185,016,364 - 185,026,059 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	181,977,044 - 181,986,772 (-)	NCBI		Celera
Cytogenetic Map	3	q27.1	NCBI
HuRef	3	180,943,007 - 180,952,730 (-)	NCBI		HuRef
CHM1_1	3	183,498,018 - 183,507,719 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	186,625,430 - 186,635,070 (-)	NCBI		T2T-CHM13v2.0

Map6d1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	20,052,059 - 20,060,108 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	20,052,053 - 20,060,108 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	20,233,309 - 20,241,358 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	20,233,303 - 20,241,358 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	20,233,382 - 20,241,431 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	20,148,791 - 20,154,863 (-)	NCBI		MGSCv36	mm8
Celera	16	20,797,081 - 20,805,013 (-)	NCBI		Celera
Cytogenetic Map	16	A3	NCBI
cM Map	16	12.39	NCBI

MAP6D1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	181,687,890 - 181,697,608 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	181,692,606 - 181,702,324 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	180,851,848 - 180,861,561 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	189,019,315 - 189,028,588 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

MAP6D1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	16,781,131 - 16,788,432 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	20,873,522 - 20,873,923 (-)	NCBI		Dog10K_Boxer_Tasha
Dog10K_Boxer_Tasha	34	20,868,517 - 20,873,468 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	16,693,414 - 16,693,823 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0	34	16,688,409 - 16,693,360 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	34	16,726,662 - 16,731,612 (-)	NCBI		UMICH_Zoey_3.1
UMICH_Zoey_3.1	34	16,731,666 - 16,732,072 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	16,722,324 - 16,727,271 (-)	NCBI		UNSW_CanFamBas_1.0
UNSW_CanFamBas_1.0	34	16,727,325 - 16,727,734 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	16,956,945 - 16,957,354 (-)	NCBI		UU_Cfam_GSD_1.0
UU_Cfam_GSD_1.0	34	16,951,941 - 16,956,891 (-)	NCBI		UU_Cfam_GSD_1.0

Map6d1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	119,903,807 - 119,911,309 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936578	5,995,529 - 6,000,692 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936578	5,995,629 - 6,003,148 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MAP6D1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	121,748,648 - 121,755,445 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	121,738,392 - 121,755,482 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	131,181,186 - 131,190,522 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MAP6D1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	5,593,259 - 5,603,781 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	5,593,327 - 5,601,936 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	14,375,675 - 14,385,812 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Map6d1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	72,685,794 - 72,690,561 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	72,683,993 - 72,692,105 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Map6d1
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	75
Count of miRNA genes:	67
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000058043
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	66422148	86241447	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	66113321	82169223	Rat
10450831	Scl80	Serum cholesterol level QTL 80	4.7	0.01	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	11	76957131	83051965	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
1354656	Bvd3	Brain ventricular dilatation QTL 3	3.64	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	69446070	82846715	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
1354593	Stl12	Serum triglyceride level QTL 12	3.36		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	11	66422148	86241447	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat

Markers in Region

RH143813

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	80,734,623 - 80,734,798 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	84,321,554 - 84,321,728	NCBI	Rnor6.0
Rnor_5.0	11	87,386,384 - 87,386,558	UniSTS	Rnor5.0
RGSC_v3.4	11	82,982,173 - 82,982,347	UniSTS	RGSC3.4
Celera	11	79,570,003 - 79,570,177	UniSTS
RH 3.4 Map	11	668.8	UniSTS
Cytogenetic Map	11	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	11	49	113	69	68	37	25	37	6	187	97	93	39	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108844	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473999	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000058043 ⟹ ENSRNOP00000054851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	80,734,148 - 80,740,377 (+)	Ensembl
Rnor_6.0 Ensembl	11	84,321,078 - 84,327,307 (+)	Ensembl

RefSeq Acc Id:

NM_001108844 ⟹ NP_001102314

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	94,238,552 - 94,244,781 (+)	NCBI
mRatBN7.2	11	80,734,148 - 80,740,377 (+)	NCBI
Rnor_6.0	11	84,321,078 - 84,327,307 (+)	NCBI
Rnor_5.0	11	87,385,908 - 87,392,137 (+)	NCBI
RGSC_v3.4	11	82,981,697 - 82,987,926 (+)	RGD
Celera	11	79,569,527 - 79,575,756 (+)	RGD

Sequence:

show sequence

CGAGCGGCATGGCGTGGCCCTGCATCAGCCGGCTGTGCTGCCTGGCCCGGCGCTGGAACCAGCT
GGACCGCTCGGACGTAGCGGTGCCGCTGACTCTGCACGGTTACCCGGACCCGGGGAGCGAGGAG
CCAGGCGCGGACTGCAGCGTCTCGCGCGGGAGCCCGTCCGTCGCCGGCGCGCGGGAGCCCAGCC
GTGCCGTGCCGCTCACCCAGTACCAGCGCGATTTCGGTGTGCGAACTGCTCGCGCGGGGTCCCG
GGATGCTGCTCAAGAGCGCGCACCGGGGCCGGGCGGCCGCAGGGGCCAGTCCTCGGCGCCCCCA
ACCCGGACGGTCTACGTGCTGCCGGTCGGGGACGCGGACGCAACTGTAGTAGCGACCACGTCTT
ATAGACAGGAATTCCAAGCTTGGACTGGAGTGAAGCCCTCAAGATCCACAAAGGCAAGAGCAGC
CAGAGTTGTCACGACTCACAGCTCCGGATGGGACCCCAGCCCTGGGGCCAGCTTCCAGGTTCCA
GAGGTGAGGAAATTCACACCAAACCCCTCAGCCATCTTTCAGACATCAGCCCCTCAGGCGCTCC
ATGTGTGACCAGCGGAAACCAATGGTTGGGGAAGCGGAGCACAGCCAGACCTACCAGGCAGAGG
CCTGGCCTGCTGCTTTGCCTACAGGAGCTGCTTGGCTGCTGGCTCTGGGCATGGTGTGGAGGCG
GGCAGAGGGTCTGGGCACTACCGGCTGCACTCAGCCTCCCTAACTGTCCTCCAGCAGTGTCAGG
GAGGGAGACGTTCTTATCTTCCAAATTGTCATTTGACATCCTTCAGTTTTTAAATCTGGTGATC
AATCCAGCTGAGACCTGAACTGCTCCAGACTAAGACGTGCACACTATCAAGTCCTTGGTAGGTT
GGTTTCACACTTTGGATGGTTTTCCCAAGATGCATGTTATATGTATATGTATATATATAATTTT
TTTTGATGACTTACGGTAGTGCAGGGCAGTATCCTCACCTTTTTGCAGCGGGCCATGTTCTTAT
CATTAAGAAATTTAGCCCAGCAGTGGTGGCAAATGCCTTTAATCCCATTGGAGGGAGACAAAGG
CTGATCTTGTGAGTCTGAGGCCAGCCTGGTCTACAGAGCAAGTGATAGGACAGCCAGAGCTACA
CAGAGAAACCCTGCCACAAAACAAATGTGGGGGAGGGGTGGGGATCAACCTTAGGTTGCCAGAA
GTAATACCTTTAATCCCGGCACTCTAGAGGCAGAGATAGAAGGATCTCTGAACTCAATGCTTTC
CTGATCCACACAGCAACTTCTAGGAGAGCCAGGGCTACACACCCCGTTTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102314	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL77988	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054851.2

RefSeq Acc Id:	NP_001102314 ⟸ NM_001108844
- UniProtKB:	D3ZT16 (UniProtKB/TrEMBL), A6JSB9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAWPCISRLCCLARRWNQLDRSDVAVPLTLHGYPDPGSEEPGADCSVSRGSPSVAGAREPSRAV PLTQYQRDFGVRTARAGSRDAAQERAPGPGGRRGQSSAPPTRTVYVLPVGDADATVVATTSYRQ EFQAWTGVKPSRSTKARAARVVTTHSSGWDPSPGASFQVPEVRKFTPNPSAIFQTSAPQALHV hide sequence

Ensembl Acc Id:

ENSRNOP00000054851 ⟸ ENSRNOT00000058043

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZT16-F1-model_v2	AlphaFold	D3ZT16	1-191	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698282

Promoter ID:

EPDNEW_R8807

Type:

single initiation site

Name:

Map6d1_1

Description:

MAP6 domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	84,321,115 - 84,321,175	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560102	AgrOrtholog
BioCyc Gene	G2FUF-20713	BioCyc
Ensembl Genes	ENSRNOG00000001911	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000058043.3	UniProtKB/TrEMBL
InterPro	STOP	UniProtKB/TrEMBL
KEGG Report	rno:363823	UniProtKB/TrEMBL
NCBI Gene	363823	ENTREZGENE
PANTHER	MAP6 DOMAIN-CONTAINING PROTEIN 1	UniProtKB/TrEMBL
	STOP	UniProtKB/TrEMBL
Pfam	MAP6	UniProtKB/TrEMBL
PhenoGen	Map6d1	PhenoGen
RatGTEx	ENSRNOG00000001911	RatGTEx
UniProt	A6JSB9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZT16	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-28	Map6d1	MAP6 domain containing 1	RGD1560102_predicted	similar to hypothetical protein FLJ12748 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560102_predicted	similar to hypothetical protein FLJ12748 (predicted)	LOC363823	similar to hypothetical protein FLJ12748	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC363823	similar to hypothetical protein FLJ12748			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar