Krt20 (keratin 20) - Rat Genome Database

Name: Krt20
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Krt20 (keratin 20) Mus musculus

Analyze

Symbol:

Krt20

Name:

keratin 20

RGD ID:

1557654

MGI Page

MGI

Description:

Predicted to enable structural molecule activity. Involved in cellular response to starvation; intermediate filament organization; and regulation of protein secretion. Predicted to be located in cytosol and intermediate filament cytoskeleton. Predicted to be active in cytoskeleton. Is expressed in genitourinary system and skin. Orthologous to human KRT20 (keratin 20).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

9030623C06Rik; CK-20; CK20; cytokeratin 20; cytokeratin-20; K20; keratin, type I cytoskeletal 20; keratin-20; KRT21

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KRT20 (keratin 20)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Krt20 (keratin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KRT20 (keratin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KRT20 (keratin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Krt20 (keratin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KRT20 (keratin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KRT20 (keratin 20)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	APOA4 (apolipoprotein A4)	HGNC	PhylomeDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Krt20 (keratin 20)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	KRT20 (keratin 20)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	krt99 (keratin 99)	Alliance	DIOPT (OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	mua-6	Alliance	DIOPT (Ensembl Compara\|OMA)
Danio rerio (zebrafish):	krt98	Alliance	DIOPT (OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ouro2	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	99,319,211 - 99,328,979 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	99,319,229 - 99,328,976 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	99,428,385 - 99,438,153 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	99,428,403 - 99,438,150 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	99,289,717 - 99,299,467 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	99,244,493 - 99,254,243 (-)	NCBI		MGSCv36	mm8
Celera	11	111,666,995 - 111,676,761 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	62.92	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenocarcinoma (ISO)

Cecal Neoplasms (ISO)

colorectal cancer (ISO)

genetic disease (ISO)

Neoplasm Metastasis (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (EXP)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-D (EXP)

2-acetamidofluorene (EXP)

4,4'-sulfonyldiphenol (EXP)

5-aza-2'-deoxycytidine (ISO)

acetamide (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (EXP,ISO)

Alisol A (ISO)

Alisol B (ISO)

Alisol C 23-acetate (ISO)

ammonium chloride (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (ISO)

bisphenol F (EXP)

cantharidin (EXP)

CGP 52608 (ISO)

chlordecone (EXP)

cyclosporin A (ISO)

D-glucose (EXP,ISO)

deoxynivalenol (EXP)

dimethylarsinic acid (ISO)

diquat (EXP)

diuron (ISO)

dodecanoic acid (EXP)

epoxiconazole (EXP)

ferroheme b (ISO)

folic acid (EXP)

fructose (EXP)

furan (ISO)

glucose (EXP,ISO)

heme b (ISO)

hydrogen peroxide (ISO)

indole-3-methanol (ISO)

methylseleninic acid (ISO)

Muraglitazar (ISO)

N,N-diethyl-m-toluamide (ISO)

N-nitrosodiethylamine (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

permethrin (ISO)

pioglitazone (EXP)

potassium dichromate (EXP)

quercetin (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

silver atom (EXP)

silver(0) (EXP)

sodium arsenite (EXP)

tacrolimus hydrate (EXP)

testosterone (ISO)

titanium dioxide (EXP)

trimellitic anhydride (EXP)

triptonide (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cellular response to starvation (IDA)

epithelial cell differentiation (IBA)

intermediate filament organization (IBA,IMP,ISO)

regulation of protein secretion (IDA)

Cellular Component

cytoplasm (ISO)

cytoskeleton (IBA)

cytosol (ISO)

intermediate filament (IEA)

intermediate filament cytoskeleton (ISO)

Molecular Function

protein binding (IPI)

structural molecule activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Cytokeratin profile relates to histological subtypes and intrahepatic location of intrahepatic cholangiocarcinoma and primary sites of metastatic adenocarcinoma of liver.	Shimonishi T, etal., Histopathology. 2000 Jul;37(1):55-63.
7.	Overexpression of CK20, MAP3K8 and EIF5A correlates with poor prognosis in early-onset colorectal cancer patients.	Tunca B, etal., J Cancer Res Clin Oncol. 2013 Apr;139(4):691-702. doi: 10.1007/s00432-013-1372-x. Epub 2013 Jan 16.
8.	Database resources of the National Center for Biotechnology Information.	Wheeler DL, etal., Nucleic Acids Res 2001 Jan 1;29(1):11-6.

Additional References at PubMed

PMID:10349636	PMID:11042159	PMID:11076861	PMID:12477932	PMID:12857878	PMID:15687259	PMID:16141072	PMID:16141073	PMID:16608857	PMID:16831889	PMID:16973199	PMID:19494835
PMID:19786578	PMID:20064391	PMID:20064392	PMID:20534675	PMID:20830809	PMID:21267068	PMID:21565611	PMID:21803035	PMID:21873635	PMID:21905163	PMID:22345400	PMID:22811268
PMID:23449535	PMID:23948231	PMID:23993789	PMID:24796293	PMID:24992712	PMID:25468937	PMID:26994968	PMID:27120339	PMID:27320313	PMID:27414999	PMID:28167773	PMID:29684311
PMID:29899403	PMID:30758073	PMID:31092921	PMID:31345929	PMID:31554819	PMID:31597917	PMID:33328632	PMID:35016013	PMID:35283102

Genomics

Comparative Map Data

Krt20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	99,319,211 - 99,328,979 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	99,319,229 - 99,328,976 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	99,428,385 - 99,438,153 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	99,428,403 - 99,438,150 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	99,289,717 - 99,299,467 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	99,244,493 - 99,254,243 (-)	NCBI		MGSCv36	mm8
Celera	11	111,666,995 - 111,676,761 (+)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	62.92	NCBI

KRT20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	40,875,889 - 40,885,242 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	40,875,889 - 40,885,242 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	39,032,141 - 39,041,494 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	36,285,719 - 36,295,005 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	36,285,720 - 36,295,005	NCBI
Celera	17	35,693,699 - 35,703,063 (-)	NCBI		Celera
Cytogenetic Map	17	q21.2	NCBI
HuRef	17	34,826,490 - 34,835,854 (-)	NCBI		HuRef
CHM1_1	17	39,267,481 - 39,276,839 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	41,740,198 - 41,749,557 (-)	NCBI		T2T-CHM13v2.0

Krt20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	84,880,952 - 84,890,285 (-)	NCBI		GRCr8
mRatBN7.2	10	84,384,790 - 84,394,125 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	84,384,802 - 84,394,107 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	89,328,471 - 89,337,664 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	88,826,600 - 88,835,793 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	84,218,570 - 84,227,763 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	87,342,514 - 87,351,045 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	87,342,619 - 87,351,045 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	87,138,402 - 87,147,209 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	88,335,894 - 88,379,899 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	88,350,263 - 88,394,269 (-)	NCBI
Celera	10	83,123,857 - 83,133,118 (-)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

KRT20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	24,058,379 - 24,076,505 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	25,952,345 - 25,966,963 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	16,396,544 - 16,408,104 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	16,624,068 - 16,633,359 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	16,624,068 - 16,633,359 (+)	Ensembl	panpan1.1		panPan2

KRT20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	21,808,171 - 21,818,301 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	21,808,548 - 21,817,387 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	21,281,126 - 21,291,858 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	22,601,128 - 22,611,856 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	22,600,545 - 22,610,038 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	21,375,627 - 21,386,343 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	21,634,361 - 21,645,081 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	21,758,632 - 21,769,369 (+)	NCBI		UU_Cfam_GSD_1.0

Krt20
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	21,222,795 - 21,236,094 (+)	NCBI		HiC_Itri_2

KRT20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	21,584,814 - 21,594,854 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	21,584,683 - 21,593,583 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	21,893,158 - 21,902,697 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KRT20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	65,296,604 - 65,307,912 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	65,298,642 - 65,311,645 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	36,177,237 - 36,186,695 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Krt20
427 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	241
Count of miRNA genes:	183
Interacting mature miRNAs:	210
Transcripts:	ENSMUST00000017743
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
1357766	Si5lq6_m	serum IGFBP-5 level QTL 6 (mouse)			Not determined		11	66733420	100733652	Mouse
1301546	Pcir2_m	periosteal circumference 2 (mouse)			Not determined		11	66733420	100733652	Mouse
1301833	Tbbmd5_m	total body bone mineral density 5 (mouse)			Not determined		11	66733420	100733652	Mouse
1300628	Lgth6_m	body length 6 (mouse)			Not determined		11	66733420	100733652	Mouse
4141012	Femwf6_m	femur work to failure 6 (mouse)			Not determined			66733420	100733652	Mouse
1300784	Prdt3_m	prion disease incubation time 3 (mouse)			Not determined		11	66733420	100733652	Mouse
27226783	Tibl5_m	tibia length 5, 5 week (mouse)					11	68190826	101890826	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70691198	104691366	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70691198	104691366	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70691198	104691366	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70691198	104691366	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72019649	106019734	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72726125	106726289	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72818615	106818733	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72818615	106818733	Mouse
11038695	Par8_m	pulmonary adenoma resistance 8 (mouse)					11	77063779	111063918	Mouse
1301414	Heal10_m	wound healing/regeneration 10 (mouse)			Not determined		11	77437183	111437322	Mouse
10045616	Heal25_m	wound healing/regeneration 25 (mouse)			Not determined		11	77437183	111437322	Mouse
1302124	Eae7_m	susceptibility to experimental allergic encephalomyelitis 7 (mouse)			Not determined		11	77573873	99377820	Mouse
10413882	Moe1_m	modifier of epilepsy 1 (mouse)					11	77770978	111771099	Mouse
1301640	Lore4_m	loss of righting induced by ethanol 4 (mouse)			Not determined		11	79156009	107616472	Mouse
14746970	Manh71_m	mandible shape 71 (mouse)					11	79416257	113416257	Mouse
10043865	T2dm5sa_m	type 2 diabetes mellitus 5 in SMXA RI mice (mouse)			Not determined		11	79813759	104502698	Mouse
27226758	Femd3_m	femur midshaft diameter 3, 5 week (mouse)					11	80890826	101890826	Mouse
1300649	Crhq1_m	compensatory renal hypertrophy QTL 1 (mouse)			Not determined		11	81574481	115574636	Mouse
1300766	Skull16_m	skull morphology 16 (mouse)			Not determined		11	81574481	115574636	Mouse
10412288	Carg4_m	Candida albicans resistance gene 4 (mouse)			Not determined		11	81810267	115810267	Mouse
1301072	Eae22_m	experimental allergic encephalomyelitis 22 (mouse)			Not determined		11	82377698	116377820	Mouse
14747003	Mancz9_m	mandible centroid size 9 (mouse)					11	85844911	119844911	Mouse
15039374	Adip29_m	adiposity 29 (mouse)					11	86608320	120608320	Mouse
15039376	Bw42_m	body weight QTL 42 (mouse)					11	86608320	120608320	Mouse
15014785	Mvlq1_m	macrovesicular liver lesion QTL 1 (mouse)					11	86608320	120608320	Mouse
27226789	Feml16_m	femur length 16, 10 week (mouse)					11	87490826	121873369	Mouse
10044007	Hbnr14_m	Heligmosomoides bakeri nematode resistance 14 (mouse)			Not determined		11	87502600	121502698	Mouse
1357631	Motr1_m	modifier of tubby retinal degeneration 1 (mouse)			Not determined		11	87691198	103274115	Mouse
11251723	Ewc5_m	ethanol withdrawal and consumption 5 (mouse)					11	89869251	121973369	Mouse
1558753	Ath19_m	atherosclerosis 19 (mouse)			Not determined		11	91604608	121973369	Mouse
1302034	Pkccl_m	protein kinase C content in lungs (mouse)			Not determined		11	91604608	121973369	Mouse
10045617	Heal26_m	wound healing/regeneration 26 (mouse)			Not determined		11	92939373	112544554	Mouse
1301095	El6_m	epilepsy 6 (mouse)			Not determined		11	93229183	121973369	Mouse
4141939	Pregq2_m	pregnancy QTL 2 (mouse)			Not determined		11	94063779	118022724	Mouse
27226731	Tibmd4_m	tibia midshaft diameter 4, 10 week (mouse)					11	94190826	118890826	Mouse
4141465	Dbm2_m	diabetes modifier 2 (mouse)			Not determined			94437183	118022724	Mouse
1301958	Alcp18_m	alcohol preference locus 18 (mouse)			Not determined		11	95403965	121973369	Mouse
1300944	Alcp20_m	alcohol preference locus 20 (mouse)			Not determined		11	95403965	121973369	Mouse
1300962	Cd8mts4_m	CD8 memory T cell subset 4 (mouse)			Not determined		11	96137674	121973369	Mouse
1301535	Pas5b_m	pulmonary adenoma susceptibility 5b (mouse)			Not determined		11	96176465	108806384	Mouse
1301057	Nidd4_m	non-insulin-dependent diabetes mellitus 4 (mouse)			Not determined		11	96810136	121973369	Mouse
1301153	Estq3_m	estradiol regulated response QTL 3 (mouse)			Not determined		11	96897693	99327028	Mouse
12910539	Sstapa3_m	suseptibility to Staphylococcus aureus infection 3 (mouse)					11	96897693	110603991	Mouse
1301983	Berr2_m	berghei resistance locus 2 (mouse)			Not determined		11	98352609	121973369	Mouse
10043976	Obq33_m	obesity QTL 33 (mouse)			Not determined		11	98500469	121973369	Mouse
10044001	Alcw8_m	alcohol withdrawal 8 (mouse)			Not determined		11	99254187	121973369	Mouse

Markers in Region

D11Mit132

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	99,436,087 - 99,436,202	UniSTS	GRCm38
MGSCv37	11	99,297,401 - 99,297,516	UniSTS	GRCm37
Celera	11	111,668,946 - 111,669,061	UniSTS
Cytogenetic Map	11	D	UniSTS
cM Map	11	58.0	UniSTS
Whitehead Genetic	11	62.3	UniSTS
Whitehead_YAC	11		UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_023256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF473907	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK018567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL591165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC038900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC057172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DS033262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000017743 ⟹ ENSMUSP00000017743

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	99,319,229 - 99,328,976 (-)	Ensembl
GRCm38.p6 Ensembl	11	99,428,403 - 99,438,150 (-)	Ensembl

RefSeq Acc Id:

NM_023256 ⟹ NP_075745

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	99,319,211 - 99,328,979 (-)	NCBI
GRCm38	11	99,428,385 - 99,438,153 (-)	NCBI
MGSCv37	11	99,289,717 - 99,299,467 (-)	RGD
Celera	11	111,666,995 - 111,676,761 (+)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

GACAGACAGGCTGTGCTCCAAGTCCAGGCTACAGGCGTTGCCTCCCTACATCCCAGATGGATTT
CAGTCGTCAAAGTTTTCACCGAAGTCTGAGTTCCTCCTCACAAGGCCCAGCACTCAGCATGAGT
GGCTCGCTGTATAGGAAGGGGACTGTGCAGCGTCTGGGGGCTGCACCCAGCGTCTATGGTGGGG
CTGGAGGCCATGGCACTCGCATCTCTGTCTCCAAAGCCGTAATGAGCTACGGGGGTGATCTCTC
CAACGGATCGGACCTGTTTGGGGGCAATGGGAAACTGGCAATGCAGAACCTGAACGACAGATTG
GCAAACTACCTAGAAAAAGTGCGCTCCCTGGAGCAATCCAATTCCAGACTTGAAGCCCAGATCA
AGCAGTGGTACGAAACCAACGCGCCGAGCACCATCCGAGACTATAGCTCCTACTACGCACAGAT
TAAAGAGCTGCAAAATCAGGTTAAGGATGCTCAAGTACAAAATGCCCAGTGCGTCCTGCGAATT
GACAATGCTAAGCTGGCTGCAGAGGACTTCAGATTGAAGTTTGAGACTGAGAGGGGAATGCGTA
TAGCTGTGGAAGCTGATCTCCAAGGCCTGAGCAAAGTTTATGATAATCTGACTCTTCAAAAGAC
AGACTTGGAAATTCAGATTGAAGAACTGAACAAGGACCTGGCCCTCCTCAAAAAGGAACATCAA
GAGGAAGTTGAGGTTCTTCGCCGGCAGCTGGGCAACAATGTCAACGTGGAGGTGGATGCTGCTC
CAGGCCTGAACCTGGGAGAGATCATGAATGAGATGAGACAGAGATATGAAGTCCTGGCCCAGAA
GAACCTGCAAGAGGCCAAAGAACAGTTCGAGAGACAGAGTCAAACTCTGCAGCAACAAGTCACA
GTGAACACGGAGGAGCTGAAAGGATTCGAGGTTCAAGTCACGGAGCTGAGACGCACCTACCAGA
ACCTGGAGATAGAGTTGCAGTCCCACCTCAGCATGAAAGAGTCTCTGGAGCGCAACCTAGAGGA
CGTCAAGGCTCGTTACGCCAGCCAGTTGGCAGCCATCCAGGAGATGCTGAGCTCCCTGGAGGCC
CAACTGATGCAGATCAGGAGTGACACAGAACGCCAGAACCAAGAACACAACATCCTTCTCGACA
TAAAGACCCGGCTTGAGCAGGAGATCGCCACCTACCGCCGCCTTCTGGAGGGAGAAGATATAAA
AACTACAGAATACCAGCTGAGCACTTTGGAAATGAAGGATATCAAGAAAACCAGGAAGATTAAG
ACGGTCGTGGAAGAAGTGGTAGACGGCAAGGTCGTGTCCTCTGAAGTCAAGGAGATAGAAGAGA
GTGTCTAACCAGCTGTCAAAGGGAGGCTGCTCCAGCTGTGGCCCGCTGAAGACAACACTGTGTA
GTGGCTTTAAAGTGTGTGTGGGGGGGGGGGAGTCTATTTATCAAGCTGTGTAATTAAATATAAA
TGGTTCACTCCAGGGAGCTGTAAAGGGCAAGATTAAACCCAGCACAATCGTCCTCATTGCAAGG
CACATCCATCACAGACCAGTTCAGGTAGAGTAAAGCATTGGAGGAGTTCAAGCAAAGAGCAAAT
AAACCGCTCTCCTTTGGGGTCTTGTTTTTCTTGTTTCTGAATTGCTAAAAGCCCCGTTAGTGAA
CGGGTTCTCCAGGGAGGCAACTTCCCAGTTAATCTCATTGTCTCCTTGCTGCCTTTAAGCCTTT
CCTGATGTCTCCCACTGCCTCTCAAAACTCAACTTAGTCTTTGAATAATTTAAAACAAACTCCA
ATCACAAATGCTGAGGAGAATAAGAACACAGCACAAGGTGATTGACATGGGGTTCAGTTAAGAG
CAAAACTAGCCTGGATGGGAATGTGTCTTCGTCTCATAATAAACTGCTTAACCATTAAAGGTGG
CTTTATTTGGTGAATCTGGAGTATAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_075745	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH57172	(Get FASTA)	NCBI Sequence Viewer
	AAL82480	(Get FASTA)	NCBI Sequence Viewer
	BAB31280	(Get FASTA)	NCBI Sequence Viewer
	EDL01048	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000017743
	ENSMUSP00000017743.3
GenBank Protein	Q9D312	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_075745 ⟸ NM_023256

- UniProtKB:

Q6PG82 (UniProtKB/Swiss-Prot), Q9D312 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MDFSRQSFHRSLSSSSQGPALSMSGSLYRKGTVQRLGAAPSVYGGAGGHGTRISVSKAVMSYGG
DLSNGSDLFGGNGKLAMQNLNDRLANYLEKVRSLEQSNSRLEAQIKQWYETNAPSTIRDYSSYY
AQIKELQNQVKDAQVQNAQCVLRIDNAKLAAEDFRLKFETERGMRIAVEADLQGLSKVYDNLTL
QKTDLEIQIEELNKDLALLKKEHQEEVEVLRRQLGNNVNVEVDAAPGLNLGEIMNEMRQRYEVL
AQKNLQEAKEQFERQSQTLQQQVTVNTEELKGFEVQVTELRRTYQNLEIELQSHLSMKESLERN
LEDVKARYASQLAAIQEMLSSLEAQLMQIRSDTERQNQEHNILLDIKTRLEQEIATYRRLLEGE
DIKTTEYQLSTLEMKDIKKTRKIKTVVEEVVDGKVVSSEVKEIEESV

hide sequence

RefSeq Acc Id:

ENSMUSP00000017743 ⟸ ENSMUST00000017743

Protein Domains

IF rod

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9D312-F1-model_v2	AlphaFold	Q9D312	1-431	view protein structure

Promoters

RGD ID:

8676574

Promoter ID:

EPDNEW_M16317

Type:

multiple initiation site

Name:

Krt20_1

Description:

Mus musculus keratin 20 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	99,438,152 - 99,438,212	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1914059	AgrOrtholog
Ensembl Genes	ENSMUSG00000035775	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000017743	ENTREZGENE
	ENSMUST00000017743.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.5.170	UniProtKB/Swiss-Prot
	Single helix bin	UniProtKB/Swiss-Prot
	Vasodilator-stimulated phosphoprotein	UniProtKB/Swiss-Prot
InterPro	IF_conserved	UniProtKB/Swiss-Prot
	IF_rod_dom	UniProtKB/Swiss-Prot
	Keratin_I	UniProtKB/Swiss-Prot
KEGG Report	mmu:66809	UniProtKB/Swiss-Prot
MGD	MGI:1914059	ENTREZGENE
NCBI Gene	66809	ENTREZGENE
PANTHER	KERATIN, TYPE I CYTOSKELETAL 20	UniProtKB/Swiss-Prot
	PTHR23239	UniProtKB/Swiss-Prot
Pfam	Filament	UniProtKB/Swiss-Prot
PhenoGen	Krt20	PhenoGen
PRINTS	TYPE1KERATIN	UniProtKB/Swiss-Prot
PROSITE	IF_ROD_1	UniProtKB/Swiss-Prot
	IF_ROD_2	UniProtKB/Swiss-Prot
SMART	Filament	UniProtKB/Swiss-Prot
Superfamily-SCOP	Intermediate filament protein, coiled coil region	UniProtKB/Swiss-Prot
UniProt	K1C20_MOUSE	UniProtKB/Swiss-Prot
	Q6PG82	ENTREZGENE
	Q9D312	ENTREZGENE
UniProt Secondary	Q6PG82	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD