Mrpl34 (mitochondrial ribosomal protein L34)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mrpl34 (mitochondrial ribosomal protein L34) Mus musculus

Analyze

Symbol:

Mrpl34

Name:

mitochondrial ribosomal protein L34

RGD ID:

1553633

MGI Page

MGI

Description:

Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Localizes to mitochondrion. Orthologous to human MRPL34 (mitochondrial ribosomal protein L34); INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

0610007O17Rik; 39S ribosomal protein L34, mitochondrial; D8Bwg1484e; L34mt; MRP-L34

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPL34 (mitochondrial ribosomal protein L34)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Mrpl34 (mitochondrial ribosomal protein L34)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Mrpl34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPL34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPL34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrpl34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPL34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	MRPL34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrpl34 (mitochondrial ribosomal protein L34)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MRPL34 (mitochondrial ribosomal protein L34)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Rattus norvegicus (Norway rat):	Mrpl34 (mitochondrial ribosomal protein L34)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Danio rerio (zebrafish):	mrpl34 (mitochondrial ribosomal protein L34)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	MRX14	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Drosophila melanogaster (fruit fly):	mRpL34	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|Roundup\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	71,917,570 - 71,918,397 (+)	NCBI	GRCm39		mm39
GRCm38	8	71,464,926 - 71,465,753 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	71,464,959 - 71,465,747 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	73,988,825 - 73,989,652 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	74,393,963 - 74,394,735 (+)	NCBI			mm8
Celera	8	73,984,143 - 73,984,970 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.43	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

acetamide (ISO)

atrazine (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (ISO)

buspirone (ISO)

clobetasol (EXP)

clofibrate (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (ISO)

elemental selenium (ISO)

folic acid (EXP)

indometacin (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

methyl methanesulfonate (ISO)

nefazodone (ISO)

nimesulide (ISO)

paracetamol (EXP,ISO)

PCB138 (ISO)

resveratrol (EXP)

selenium atom (ISO)

sunitinib (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thalidomide (EXP)

valproic acid (ISO)

vinclozolin (ISO)

vitamin E (ISO)

xylitol (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

translation (ISO)

Cellular Component

mitochondrial large ribosomal subunit (IBA,ISO)

mitochondrion (HDA,ISO)

ribosome (IEA)

Molecular Function

structural constituent of ribosome (ISO)

References

References - curated


1.	Brady KP, etal., Genome Res 1997 Nov;7(11):1085-93.
2.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.	MGD data from the GO Consortium
4.	Mootha VK, etal., Cell 2003 Nov 26;115(5):629-40.
5.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.	RGD automated import pipeline for gene-chemical interactions
7.	Suzuki T, etal., J Biol Chem 2001 Jun 15;276(24):21724-36. Epub 2001 Feb 21.

Additional References at PubMed

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:12477932	PMID:14610273	PMID:15489334	PMID:16141072	PMID:16141073	PMID:18614015	PMID:21677750	PMID:21873635
PMID:32325033	PMID:32987154

Genomics

Comparative Map Data

Mrpl34
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	71,917,570 - 71,918,397 (+)	NCBI	GRCm39		mm39
GRCm38	8	71,464,926 - 71,465,753 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	71,464,959 - 71,465,747 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	73,988,825 - 73,989,652 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	74,393,963 - 74,394,735 (+)	NCBI			mm8
Celera	8	73,984,143 - 73,984,970 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.43	NCBI

MRPL34
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	19	17,292,609 - 17,306,843 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	19	17,302,865 - 17,306,843 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	19	17,413,616 - 17,417,652 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	17,277,477 - 17,278,652 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	19	17,277,476 - 17,278,652	NCBI
Celera	19	17,318,207 - 17,319,381 (+)	NCBI
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	16,983,036 - 16,984,210 (+)	NCBI		HuRef
CHM1_1	19	17,415,950 - 17,417,125 (+)	NCBI		CHM1_1

Mrpl34
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	16	19,874,034 - 19,874,769 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	19,874,034 - 19,874,768 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	19,734,113 - 19,736,135 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	18,636,144 - 18,636,879 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	16	18,636,141 - 18,636,876 (+)	NCBI
Celera	16	18,357,549 - 18,358,284 (+)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

Mrpl34
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955524	922,148 - 923,107 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955524	922,148 - 923,107 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPL34
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	19	17,767,706 - 17,768,880 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	17,767,706 - 17,768,880 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	19	16,793,461 - 16,794,635 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

MRPL34
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	20	45,449,611 - 45,450,501 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	20	45,449,510 - 45,451,934 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Mrpl34
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936596	3,555,655 - 3,556,759 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPL34
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	60,377,905 - 60,378,874 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	60,377,904 - 60,378,967 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

MRPL34
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	15,812,233 - 15,813,425 (+)	NCBI
ChlSab1.1 Ensembl	6	15,811,876 - 15,813,958 (+)	Ensembl

Mrpl34
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624908	638,460 - 639,430 (-)	NCBI

Position Markers

RH125067

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	71,465,498 - 71,465,620	UniSTS	GRCm38
MGSCv37	8	73,989,397 - 73,989,519	UniSTS	GRCm37
Celera	8	73,984,715 - 73,984,837	UniSTS
Cytogenetic Map	8	C1	UniSTS
Cytogenetic Map	8	B3.3	UniSTS

D8Bwg1484e

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	71,465,548 - 71,465,717	UniSTS	GRCm38
MGSCv37	8	73,989,447 - 73,989,616	UniSTS	GRCm37
Celera	8	73,984,765 - 73,984,934	UniSTS
Cytogenetic Map	8	B3.3	UniSTS
cM Map	8	33.5	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32016544	117238700	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	34642776	114837007	Mouse
1301013	Capsq4_m	capsaicin sensitivity related QTL 4 (mouse)			Not determined		8	36163000	92728652	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37400000	109600000	Mouse
12904744	Carcdq1_m	cardiac collagen deposition QTL 1 (mouse)					8	39709256	94689598	Mouse
1301544	Iba3_m	induction of brown adipocytes 3 (mouse)			Not determined		8	44294880	78295025	Mouse
1301717	Adip4_m	adiposity 4 (mouse)			Not determined		8	47637030	81637146	Mouse
10766453	Char11_m	P. chabaudi malaria resistance QTL 11 (mouse)					8	47637030	81637146	Mouse
1301441	Skull11_m	skull morphology 11 (mouse)			Not determined		8	47737134	81737254	Mouse
1357715	Alaa3_m	alopecia areata 3 (mouse)			Not determined		8	48792939	82793021	Mouse
14746987	Manh64_m	mandible shape 64 (mouse)					8	50053306	84053306	Mouse
14747005	Mancz7_m	mandible centroid size 7 (mouse)					8	50053306	84053306	Mouse
14700686	Civq3_m	cerebral infarct volume QTL 3 (mouse)					8	51882191	85882191	Mouse
1301506	Aevm1_m	autoimmune extremity vasculitis in MRL mice 1 (mouse)			Not determined		8	54287817	88287993	Mouse
1301952	Im3_m	immunoregulatory 3 (mouse)			Not determined		8	54706614	88706763	Mouse
10412287	Carg3_m	Candida albicans resistance gene 3 (mouse)			Not determined		8	55545028	89545028	Mouse
11353828	Gf7_m	gonadal fat pad weight 7 (mouse)					8	58201479	92201479	Mouse
10043975	Obq31_m	obesity QTL 31 (mouse)			Not determined		8	58409776	92409776	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	60786850	94786976	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			63460107	97460107	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	63939547	97939696	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	65357768	99357920	Mouse
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	65600207	99600347	Mouse
10766466	Char12_m	P. chabaudi malaria resistance QTL 12 (mouse)					8	68269827	82600347	Mouse
1301767	Fcsa2_m	femoral cross-sectional area 2 (mouse)			Not determined		8	70305375	104305495	Mouse
4142283	Imraq2_m	immune response to AAV2 QTL 2 (mouse)			Not determined		8	70305375	104305495	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71102903	105103009	Mouse
4141395	Char2a_m	P. chabaudi malaria resistance QTL 2a (mouse)			Not determined			71136783	90202598	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71287817	123895615	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71287817	123895615	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	71396181	105396393	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	96
Interacting mature miRNAs:	101
Transcripts:	ENSMUST00000048914
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB049653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC127416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK018724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK170156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC052086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC056979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ174895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY290822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L12981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000048914 ⟹ ENSMUSP00000044497

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	8	71,464,959 - 71,465,747 (+)	Ensembl

RefSeq Acc Id:

NM_053162 ⟹ NP_444392

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	71,917,570 - 71,918,397 (+)	NCBI
GRCm38	8	71,464,926 - 71,465,753 (+)	ENTREZGENE
MGSCv37	8	73,988,825 - 73,989,652 (+)	RGD
Celera	8	73,984,143 - 73,984,970 (+)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

GAAGGCATTGTCAAGGAGCCCAGAGTGTAGGAACTGGCATTGACCCGGACGACCGGACCATTGA
CCCGCCGCTGGATATGGCTTTCCTAGCCCGGTGCTTTGGGTGCCAGGCCTGCAGATCGGTGGCC
CTATTGAGTGGCAGGTATCTCCAGTCCAGAGTCTGGATGGGGCTCCCGGACTCCTGGCCTCTCC
TCTCCCTGCAGCAGGCTCGCGGCCGCGCGCGCGGAAACGAGTATCAGCCGAGCAACATCAAGCG
CAAGCACAAGCACGGCTGGGTCCGTCGGCTGAGCACGCCTGCCGGCGTGCAGGTCATCCTCCGT
CGCATGCTGAAGGGCCGCAAGTCCCTGAGCCACTGAGGAGCGCAACGTCGCAGGGAATAGACTC
AGACGCCGGTAGAGTTGCCCGAGGGCGAGAAGTTGGGGCAAGCTGAAAGTGGGGGTCTGTCCCT
TCGTAGGTTTTTAGACGCATCCCCCGTCGACGGCTGCTTACCAACCACCAGCACCTGCGATACC
TCATCCATTTCTGTGAATATATTTGAAGGCATCTTTGCAAGACGGGGTCATTAAAACACAGACA
CCACCCCTACGTTTCCAGCCATTCCAAAGTATTACCGACTTAATAAATATTCACGTTTCTTGAA
CCACTAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_444392	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH52086	(Get FASTA)	NCBI Sequence Viewer
	AAH56979	(Get FASTA)	NCBI Sequence Viewer
	BAB40858	(Get FASTA)	NCBI Sequence Viewer
	BAC25562	(Get FASTA)	NCBI Sequence Viewer
	BAE41603	(Get FASTA)	NCBI Sequence Viewer
	EDL28922	(Get FASTA)	NCBI Sequence Viewer
	Q99N91	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_444392 ⟸ NM_053162
- UniProtKB:	Q99N91 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAFLARCFGCQACRSVALLSGRYLQSRVWMGLPDSWPLLSLQQARGRARGNEYQPSNIKRKHKH GWVRRLSTPAGVQVILRRMLKGRKSLSH hide sequence

RefSeq Acc Id:

ENSMUSP00000044497 ⟸ ENSMUST00000048914

Promoters

RGD ID:

8667395

Promoter ID:

EPDNEW_M11729

Type:

initiation region

Name:

Mrpl34_1

Description:

Mus musculus mitochondrial ribosomal protein L34 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	71,464,947 - 71,465,007	EPDNEW

RGD ID:

6843490

Promoter ID:

MM_KWN:54783

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day2, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_053162

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	8	73,988,551 - 73,989,051 (+)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:2137227	AgrOrtholog
Ensembl Genes	ENSMUSG00000034880	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000044497	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000048914	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	Ribosomal_L34	UniProtKB/Swiss-Prot
KEGG Report	mmu:94065	UniProtKB/Swiss-Prot
MGD	MGI:2137227	ENTREZGENE
NCBI Gene	94065	ENTREZGENE
PANTHER	PTHR14503	UniProtKB/Swiss-Prot
Pfam	Ribosomal_L34	UniProtKB/Swiss-Prot
PhenoGen	Mrpl34	PhenoGen
TIGRFAMs	rpmH_bact	UniProtKB/Swiss-Prot
UniGene	Mm.29489	ENTREZGENE
UniProt	Q99N91	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q3TDJ8	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)