Reg3g (regenerating islet-derived 3 gamma)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Reg3g (regenerating islet-derived 3 gamma) Mus musculus

Analyze

Symbol:

Reg3g

Name:

regenerating islet-derived 3 gamma

RGD ID:

1552800

MGI Page

MGI

Description:

Is expressed in several structures, including epithelium; gut; pharyngo-tympanic tube; thymus; and trachea. Orthologous to human REG3G (regenerating family member 3 gamma).

Type:

protein-coding

RefSeq Status:

REVIEWED

Also known as:

AI449515; generating islet-derived, mouse homolog 3 gamma; pancreatitis-associated protein 3; reg III-gamma; REG-3-gamma; regenerating islet-derived protein 3-gamma; regenerating islet-derived protein III-gamma; RegIII (gamma)

RGD Orthologs

Human

Rat

Bonobo

Dog

Squirrel

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	REG3G (regenerating family member 3 gamma)	HGNC	Ensembl, HGNC, HomoloGene, OMA, OrthoDB, Panther, PhylomeDB
Rattus norvegicus (Norway rat):	Reg3g (regenerating family member 3 gamma)	RGD	RGD
Pan paniscus (bonobo/pygmy chimpanzee):	REG3G (regenerating family member 3 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	REG3A (regenerating islet-derived 3 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Reg3g (regenerating family member 3 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	REG3G (regenerating family member 3 gamma)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	REG3A (regenerating family member 3 alpha)	HGNC	OMA, OrthoDB, Panther, PhylomeDB
Homo sapiens (human):	REG1B (regenerating family member 1 beta)	HGNC	Ensembl
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Reg3g (regenerating family member 3 gamma)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Homo sapiens (human):	REG3G (regenerating family member 3 gamma)	Alliance	DIOPT (Ensembl Compara\|HGNC\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:dkey-241l7.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	lectin	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:ch211-125e6.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:ch211-125e6.12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:dkey-241l7.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:dkey-241l7.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:dkey-241l7.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:dkeyp-75b4.10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:ch211-125e6.11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Danio rerio (zebrafish):	si:dkey-9i23.4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	zgc:172053	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Caenorhabditis elegans (roundworm):	clec-178	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	Y38H6C.8	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	clec-86	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	clec-150	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|Roundup)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	78,443,252 - 78,445,857 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	78,443,252 - 78,445,855 (-)	Ensembl
GRCm38	6	78,466,269 - 78,468,874 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	78,466,269 - 78,468,872 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	78,416,262 - 78,418,868 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	78,395,777 - 78,398,383 (-)	NCBI			mm8
Celera	6	80,489,179 - 80,491,785 (-)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (EXP)

ammonium chloride (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP)

arsane (EXP)

arsenic atom (EXP)

arsenite(3-) (EXP)

benzalkonium chloride (EXP)

benzo[a]pyrene (EXP,ISO)

Benzo[k]fluoranthene (EXP)

benzylpenicillin (EXP)

bisphenol A (ISO)

bisphenol F (EXP)

C60 fullerene (ISO)

carbon nanotube (EXP)

chloroprene (EXP)

clothianidin (ISO)

cocaine (ISO)

curcumin (EXP)

cyclophosphamide (EXP,ISO)

dextran sulfate (EXP)

diclofenac (EXP)

erythromycin A (EXP)

furan (ISO)

irinotecan (ISO)

isoprenaline (ISO)

lipopolysaccharide (EXP,ISO)

losartan (ISO)

metformin (ISO)

nickel sulfate (EXP)

ozone (EXP)

phenformin (ISO)

pirinixic acid (EXP)

rotenone (ISO)

SB 203580 (ISO)

silicon dioxide (EXP)

sodium arsenite (EXP)

sodium dichromate (ISO)

titanium dioxide (EXP)

tremolite asbestos (EXP)

Triptolide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acute-phase response (IEA)

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,IDA,ISO)

cell wall disruption in other organism (IBA,IDA,ISO)

cytolysis by host of symbiont cells (IDA,ISO)

defense response to Gram-negative bacterium (IDA)

defense response to Gram-positive bacterium (IDA,IMP)

inflammatory response (IEA)

MyD88-dependent toll-like receptor signaling pathway (IMP)

negative regulation of keratinocyte differentiation (IDA)

positive regulation of cell population proliferation (IBA)

positive regulation of keratinocyte proliferation (IDA)

positive regulation of wound healing (IDA)

response to bacterium (IEP)

response to peptide hormone (IBA)

Cellular Component

collagen-containing extracellular matrix (HDA)

cytoplasm (IEA)

extracellular region (IEA)

extracellular space (IDA)

secretory granule (IDA)

Molecular Function

carbohydrate binding (IEA)

oligosaccharide binding (IBA,IDA,ISO)

peptidoglycan binding (IBA,IDA,ISO)

signaling receptor activity (IBA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal feces composition (IAGP)

abnormal gut flora balance (IAGP)

abnormal intestine physiology (IAGP)

increased circulating cholesterol level (IEA)

increased circulating HDL cholesterol level (IEA)

increased circulating LDL cholesterol level (IEA)

increased IgA level (IAGP)

increased susceptibility to Orthomyxoviridae infection (IAGP)

increased T-helper 1 cell number (IAGP)

References

References - curated


1.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGD data from the GO Consortium
3.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	RGD automated import pipeline
5.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9055810	PMID:10349636	PMID:10767532	PMID:11042159	PMID:11076861	PMID:12477932	PMID:15489334	PMID:15582152	PMID:16141072	PMID:16141073	PMID:16602821	PMID:16931762
PMID:17198697	PMID:17522155	PMID:17635956	PMID:17936263	PMID:18374910	PMID:19095652	PMID:19494835	PMID:20050810	PMID:21267068	PMID:21677750	PMID:21681751	PMID:21873635
PMID:21926556	PMID:21998396	PMID:22723890	PMID:22727489	PMID:23012479	PMID:23401489	PMID:24345802	PMID:25263220	PMID:25301498	PMID:26329040	PMID:26431947	PMID:26667474
PMID:26866937	PMID:26867181	PMID:27193261	PMID:27798352	PMID:27912059	PMID:28071719	PMID:28424327	PMID:28580440	PMID:28811323	PMID:28880262	PMID:29850784	PMID:30089902
PMID:30106382	PMID:30831322	PMID:31132747	PMID:31404030	PMID:31817820	PMID:32560820

Genomics

Comparative Map Data

Reg3g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	78,443,252 - 78,445,857 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	78,443,252 - 78,445,855 (-)	Ensembl
GRCm38	6	78,466,269 - 78,468,874 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	78,466,269 - 78,468,872 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	78,416,262 - 78,418,868 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	78,395,777 - 78,398,383 (-)	NCBI			mm8
Celera	6	80,489,179 - 80,491,785 (-)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI

REG3G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	2	79,025,686 - 79,028,505 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	2	79,025,664 - 79,028,502 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	2	79,252,828 - 79,255,627 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	79,106,334 - 79,109,139 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	2	79,164,480 - 79,167,283	NCBI
Celera	2	79,081,561 - 79,084,366 (+)	NCBI
Cytogenetic Map	2	p12	NCBI
HuRef	2	78,988,763 - 78,991,579 (+)	NCBI		HuRef
CHM1_1	2	79,182,125 - 79,184,941 (+)	NCBI		CHM1_1

Reg3g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	110,922,805 - 110,927,803 (-)	NCBI
Rnor_6.0 Ensembl	4	109,529,679 - 109,532,234 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	4	109,529,679 - 109,532,234 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	174,231,309 - 174,233,865 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	112,418,258 - 112,420,813 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	4	112,662,738 - 112,665,294 (-)	NCBI
Celera	4	99,956,121 - 99,958,676 (-)	NCBI		Celera
Cytogenetic Map	4	q33	NCBI

REG3G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	80,680,650 - 80,683,470 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	80,680,615 - 80,683,748 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	79,116,083 - 79,118,886 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

REG3A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	17	44,859,137 - 44,861,899 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	17	44,859,106 - 44,864,793 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Reg3g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936556	4,896,141 - 4,898,240 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

REG3G
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	28,213,731 - 28,217,299 (-)	NCBI

Position Markers

AI449515

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	78,466,783 - 78,466,863	UniSTS	GRCm38
MGSCv37	6	78,416,777 - 78,416,857	UniSTS	GRCm37
Celera	6	80,489,694 - 80,489,774	UniSTS
Cytogenetic Map	6	C3	UniSTS
Whitehead/MRC_RH	6	794.34	UniSTS

D63361

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	78,466,311 - 78,466,446	UniSTS	GRCm38
MGSCv37	6	78,416,305 - 78,416,440	UniSTS	GRCm37
Celera	6	80,489,222 - 80,489,357	UniSTS
Cytogenetic Map	6	C3	UniSTS
Whitehead/MRC_RH	6	794.54	UniSTS

Reg3g

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	6	C3	UniSTS
cM Map	6		UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	1	117500000	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139100000	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87426034	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96656149	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96656149	Mouse
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96656149	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96656149	Mouse
26884441	Sklq3_m	skull length QTL 3, 5 week (mouse)					6	7600000	80600000	Mouse
13208564	Bmiq7_m	body mass index QTL 7 (mouse)					6	25000000	80000000	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38669625	92607450	Mouse
1300618	Pgia19_m	proteoglycan induced arthritis 19 (mouse)			Not determined		6	45314059	87426034	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45314059	128835032	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46935985	136423692	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48720000	125360000	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48720000	148450000	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48726556	125356785	Mouse
1301254	Skts11_m	skin tumor susceptibility 11 (mouse)			Not determined		6	51179150	85179300	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52161713	116155267	Mouse
4141028	Mclr_m	methylcholanthrene lymphoma resistance (mouse)			Not determined			54373427	88379171	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56308211	90308211	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56308211	90308211	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58447583	92447710	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58540433	92540433	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60057680	94057799	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63484738	97484905	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66713869	100714031	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70425898	104426034	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70425898	104426034	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70425898	104426034	Mouse
4141990	Etax6_m	ethanol induced ataxia 6 (mouse)			Not determined			71322621	86275719	Mouse
1302020	Bbaa20_m	B.burgdorferi-associated arthritis 20 (mouse)			Not determined		6	71322621	93464093	Mouse
1300869	Stheal5_m	soft tissue heal 5 (mouse)			Not determined		6	71575060	105575178	Mouse
1300954	Fcsa1_m	femoral cross-sectional area 1 (mouse)			Not determined		6	71981024	105981170	Mouse
1301521	Pas1c_m	pulmonary adenoma susceptibility 1c (mouse)			Not determined		6	71981024	105981170	Mouse
13506930	Recrq9_m	recombination rate in male meiosis QTL 9 (mouse)					6	73500000	134700000	Mouse
1301320	Ots1_m	ovarian teratoma susceptibility 1 (mouse)			Not determined		6	75447583	104503555	Mouse
1301571	Arrd1_m	age-related retinal degeneration 1 (mouse)			Not determined		6	75544356	92607450	Mouse
1300674	Nidd3n_m	non-insulin-dependent diabetes mellitus 3 in NSY (mouse)			Not determined		6	75544356	94225955	Mouse
10412195	Efw_m	epididymal fat weight (mouse)			Not determined		6	75544356	94225955	Mouse
10043901	Pfat5_m	predicted fat percentage 5 (mouse)			Not determined		6	75607306	109607450	Mouse
10412208	Cypr4_m	cytokine production 4 (mouse)			Not determined		6	75716503	109716697	Mouse
1357875	Pfat2_m	predicted fat percentage 2 (mouse)			Not determined		6	76463949	110464093	Mouse
14697704	Stsl4_m	Salmonella typhimurium susceptibility locus 4 (mouse)					6	77100000	90000000	Mouse
13824985	Alh1_m	amplitude of lateral head displacement 1 (mouse)					6	78000000	97000000	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	230
Count of miRNA genes:	194
Interacting mature miRNAs:	204
Transcripts:	ENSMUST00000032089, ENSMUST00000176650
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_011260	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB035216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB035220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC113058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC046602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF020649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D63361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D63362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000032089 ⟹ ENSMUSP00000032089

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	78,466,269 - 78,468,872 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000176650

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	78,466,269 - 78,468,571 (-)	Ensembl

RefSeq Acc Id:

NM_011260 ⟹ NP_035390

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	78,443,252 - 78,445,857 (-)	NCBI
GRCm38	6	78,466,269 - 78,468,874 (-)	NCBI
MGSCv37	6	78,416,262 - 78,418,868 (-)	RGD
Celera	6	80,489,179 - 80,491,785 (-)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

ACACCATCCTAGGGATCTGCAAGACAGACAAGATGCTTCCCCGTATAACCATCACCATCATGTC
CTGGATGCTGCTCTCCTGCCTGATGCTCCTTTCTCAGGTGCAAGGTGAAGTTGCCAAGAAAGAT
GCCCCATCTTCACGTAGCAGCTGCCCCAAGGGCTCCCGTGCCTATGGCTCCTATTGCTATGCCT
TGTTTAGTGTATCTAAAAACTGGTATGATGCAGATATGGCCTGCCAAAAGAGGCCCTCAGGACA
TCTTGTGTCTGTGCTCAGTGGCGCTGAAGCTTCCTTCCTGTCCTCCATGATCAAAAGCAGTGGT
AACAGTGGCCAATATGTATGGATTGGGCTCCATGACCCGACACTGGGCTATGAACCCAACAGAG
GTGGATGGGAGTGGAGCAATGCTGATGTGATGAATTACATCAACTGGGAGACGAATCCTTCCTC
TTCCTCAGGCAATCACTGTGGTACCCTGTCAAGAGCCTCAGGATTTCTGAAGTGGAGAGAGAAT
TATTGTAACTTAGAGTTACCCTATGTCTGCAAATTCAAGGCCTAGAGTACAGAATTGACATCAT
GGGTTGATATATACCTAGCCACAAGCAAGATCCCAAATGTGAAGACAGATGAAAAAGGGAACAT
TCTCCCCACAATCGAAATCTGACCTCCTGATTTTCTCCTTCTCTGGCCCTTCCCTCCTCTCATT
TGAGGAACTCTGTGTGCACTATGGCCTTAATTCTCAAAGCATAATATTAAAGTATATAACTCAT
GCTCAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_035390	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61139	(Get FASTA)	NCBI Sequence Viewer
	BAA18930	(Get FASTA)	NCBI Sequence Viewer
	BAA18931	(Get FASTA)	NCBI Sequence Viewer
	BAB25674	(Get FASTA)	NCBI Sequence Viewer
	BAB25774	(Get FASTA)	NCBI Sequence Viewer
	EDK99020	(Get FASTA)	NCBI Sequence Viewer
	O09049	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_035390 ⟸ NM_011260
- Peptide Label:	preproprotein
- UniProtKB:	O09049 (UniProtKB/Swiss-Prot), Q545I1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLPRITITIMSWMLLSCLMLLSQVQGEVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDA DMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVM NYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA hide sequence

RefSeq Acc Id:

ENSMUSP00000032089 ⟸ ENSMUST00000032089

Protein Domains

C-type lectin

Promoters

RGD ID:

6890074

Promoter ID:

EPDNEW_M8487

Type:

initiation region

Name:

Reg3g_2

Description:

Mus musculus regenerating islet-derived 3 gamma , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M8488

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	78,468,596 - 78,468,656	EPDNEW

RGD ID:

6890076

Promoter ID:

EPDNEW_M8488

Type:

multiple initiation site

Name:

Reg3g_1

Description:

Mus musculus regenerating islet-derived 3 gamma , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M8487

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	78,468,869 - 78,468,929	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:109406	AgrOrtholog
Ensembl Genes	ENSMUSG00000030017	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000032089	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000032089	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.10.100.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	C-type_lectin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C-type_lectin-like/link_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTDL_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:19695	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:109406	ENTREZGENE
NCBI Gene	19695	ENTREZGENE
Pfam	Lectin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Reg3g	PhenoGen
PROSITE	C_TYPE_LECTIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	CLECT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56436	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	O09049	ENTREZGENE
	Q545I1	ENTREZGENE, UniProtKB/TrEMBL
	REG3G_MOUSE	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD