Has1 (hyaluronan synthase 1) - Rat Genome Database

Name: Has1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Has1 (hyaluronan synthase 1) Mus musculus

Analyze

Symbol:

Has1

Name:

hyaluronan synthase 1

RGD ID:

1552209

MGI Page

MGI

Description:

Enables hyaluronan synthase activity. Involved in extracellular matrix assembly and extracellular polysaccharide biosynthetic process. Acts upstream of or within hyaluronan biosynthetic process. Located in cytoplasm and membrane. Is expressed in several structures, including alimentary system epithelium; face; gonad; heart; and skin. Orthologous to human HAS1 (hyaluronan synthase 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

HA synthase 1; HAS; hyaluronan synthase1; hyaluronate synthase 1; hyaluronic acid synthase 1; MGC159127; MGC159129

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HAS1 (hyaluronan synthase 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Has1 (hyaluronan synthase 1)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HAS1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Has1 (hyaluronan synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Has1 (hyaluronan synthase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	HAS1 (hyaluronan synthase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	has1 (hyaluronan synthase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	CHS3	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|Roundup)
Drosophila melanogaster (fruit fly):	Chs2	Alliance	DIOPT (OrthoInspector\|Roundup\|TreeFam)
Caenorhabditis elegans (roundworm):	chs-2	Alliance	DIOPT (OrthoInspector\|Roundup\|TreeFam)
Drosophila melanogaster (fruit fly):	kkv	Alliance	DIOPT (OrthoInspector\|Roundup\|TreeFam)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	18,063,588 - 18,075,450 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	17	18,063,585 - 18,075,467 (-)	Ensembl
GRCm38	17	17,833,691 - 17,855,589 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	17,843,323 - 17,855,205 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	17,980,290 - 17,992,152 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	17	17,547,941 - 17,559,804 (-)	NCBI			mm8
Celera	17	18,784,007 - 18,795,939 (-)	NCBI		Celera
Cytogenetic Map	17	A3.2	NCBI
cM Map	17	10.53	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cardiomegaly (ISO)

Kidney Reperfusion Injury (ISO)

pulmonary hypertension (ISO)

tuberculosis (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,4-phenylenediamine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (EXP)

5-aza-2'-deoxycytidine (EXP)

acrylamide (ISO)

ammonium chloride (ISO)

amphetamine (ISO)

antirheumatic drug (ISO)

aristolochic acid (ISO)

arsenite(3-) (EXP)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

carbon nanotube (EXP)

chlorogenic acid (ISO)

crocidolite asbestos (ISO)

dexamethasone (ISO)

dioxygen (EXP,ISO)

furan (ISO)

genistein (ISO)

gentamycin (ISO)

graphite (ISO)

hyaluronic acid (ISO)

Indeno[1,2,3-cd]pyrene (EXP)

indometacin (ISO)

lead(0) (ISO)

lead(2+) (ISO)

Licochalcone B (ISO)

methylparaben (ISO)

Osajin (ISO)

ozone (EXP)

paracetamol (ISO)

paraquat (ISO)

progesterone (ISO)

puerarin (ISO)

resveratrol (ISO)

Rosavin (ISO)

sodium arsenite (ISO)

Tesaglitazar (ISO)

tetrachloromethane (EXP)

thioacetamide (ISO)

trichloroethene (ISO)

triclosan (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to platelet-derived growth factor stimulus (ISO)

estrous cycle (ISO)

extracellular matrix assembly (IBA,IDA)

extracellular polysaccharide biosynthetic process (IBA,IDA)

hyaluronan biosynthetic process (IBA,IDA,IMP)

negative regulation of fibroblast migration (ISO)

Cellular Component

cytoplasm (IDA)

Golgi apparatus (ISO)

integral component of membrane (IEA)

integral component of plasma membrane (IBA)

membrane (IDA)

plasma membrane (IDA,ISO)

Molecular Function

glycosyltransferase activity (IEA)

hyaluronan synthase activity (IBA,IDA)

identical protein binding (ISO)

protein binding (ISO)

transferase activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased eosinophil cell number (IEA)

increased basophil cell number (IEA)

increased mean corpuscular hemoglobin concentration (IEA)

no abnormal phenotype detected (IAGP)

References

References - curated


1.	Decleves AE, etal., Nephrol Dial Transplant. 2012 Oct;27(10):3771-81. doi: 10.1093/ndt/gfs098. Epub 2012 Apr 23.
2.	Hellman U, etal., Cell Tissue Res. 2008 Jan 15;.
3.	Hirayama Y, etal., PLoS Pathog. 2009 Oct;5(10):e1000643. doi: 10.1371/journal.ppat.1000643. Epub 2009 Oct 30.
4.	MGD data from the GO Consortium
5.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.	Ormiston ML, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Feb;298(2):L148-57. doi: 10.1152/ajplung.00097.2009. Epub 2009 Nov 13.
7.	RGD automated import pipeline
8.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:13782	PMID:8626618	PMID:8798544	PMID:8889548	PMID:9016821	PMID:9169154	PMID:9206724	PMID:9442026	PMID:9457904	PMID:9494089	PMID:10093717	PMID:10349636
PMID:10455188	PMID:10617644	PMID:11006212	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11431361	PMID:12477932	PMID:14681479	PMID:14724275	PMID:15765504	PMID:15854028
PMID:16110480	PMID:16141072	PMID:16141073	PMID:19320776	PMID:20823158	PMID:21267068	PMID:21677750	PMID:21850020	PMID:21873635	PMID:22529214	PMID:22654110	PMID:22785117
PMID:23129777	PMID:23382716	PMID:24057227	PMID:24194600	PMID:24790187	PMID:25384213	PMID:26521733	PMID:27289075	PMID:27626380	PMID:28863216	PMID:29672913	PMID:29966020
PMID:30897620	PMID:32623025	PMID:33454424

Genomics

Comparative Map Data

Has1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	18,063,588 - 18,075,450 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	17	18,063,585 - 18,075,467 (-)	Ensembl
GRCm38	17	17,833,691 - 17,855,589 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	17,843,323 - 17,855,205 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	17,980,290 - 17,992,152 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	17	17,547,941 - 17,559,804 (-)	NCBI			mm8
Celera	17	18,784,007 - 18,795,939 (-)	NCBI		Celera
Cytogenetic Map	17	A3.2	NCBI
cM Map	17	10.53	NCBI

HAS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	51,713,112 - 51,723,991 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	19	51,713,112 - 51,723,991 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	52,216,365 - 52,227,244 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	56,908,177 - 56,919,033 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	19	56,908,176 - 56,919,033	NCBI
Celera	19	49,265,901 - 49,276,762 (-)	NCBI
Cytogenetic Map	19	q13.41	NCBI
HuRef	19	48,547,305 - 48,558,022 (-)	NCBI		HuRef
CHM1_1	19	52,218,163 - 52,229,047 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	54,800,274 - 54,811,173 (-)	NCBI

Has1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	58,693,411 - 58,705,653 (-)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	1	58,693,411 - 58,705,397 (-)	Ensembl
Rnor_6.0	1	59,720,612 - 59,732,409 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	59,720,612 - 59,732,409 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	60,640,270 - 60,652,067 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	56,503,365 - 56,516,133 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	1	56,506,309 - 56,519,078 (-)	NCBI
Celera	1	54,874,356 - 54,879,329 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

Has1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955558	826,853 - 836,809 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955558	826,853 - 836,809 (+)	NCBI	ChiLan1.0	ChiLan1.0

HAS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	19	57,537,049 - 57,547,804 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	57,537,049 - 57,547,804 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	19	48,657,165 - 48,668,130 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

HAS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	105,376,091 - 105,386,043 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	105,376,536 - 105,385,134 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	104,949,702 - 104,959,564 (+)	NCBI
ROS_Cfam_1.0	1	105,886,101 - 105,895,963 (+)	NCBI
ROS_Cfam_1.0 Ensembl	1	105,885,956 - 105,895,628 (+)	Ensembl
UMICH_Zoey_3.1	1	105,558,334 - 105,568,196 (+)	NCBI
UNSW_CanFamBas_1.0	1	105,199,396 - 105,209,300 (+)	NCBI
UU_Cfam_GSD_1.0	1	105,994,224 - 106,004,086 (+)	NCBI

Has1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	4,768,242 - 4,775,106 (+)	NCBI
SpeTri2.0	NW_004937026	125,622 - 132,141 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HAS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	58,307,029 - 58,313,486 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	58,303,274 - 58,313,486 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	51,877,028 - 51,888,298 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HAS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	44,540,036 - 44,552,396 (-)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	6	44,540,363 - 44,547,711 (-)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666073	24,594,280 - 24,606,885 (-)	NCBI	Vero_WHO_p1.0

Has1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	3,329,920 - 3,336,290 (+)	Ensembl	HetGla_female_1.0		hetGla2
HetGla 1.0	NW_004624832	3,327,626 - 3,341,928 (+)	NCBI	HetGla_female_1.0		hetGla2

Position Markers

AW488161

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	17	17,843,598 - 17,843,685	UniSTS	GRCm38
MGSCv37	17	17,980,562 - 17,980,649	UniSTS	GRCm37
Celera	17	18,784,279 - 18,784,366	UniSTS
Cytogenetic Map	17	A3.2	UniSTS
Whitehead/MRC_RH	17	235.56	UniSTS

D82964

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	17	17,843,386 - 17,843,470	UniSTS	GRCm38
MGSCv37	17	17,980,350 - 17,980,434	UniSTS	GRCm37
Celera	17	18,784,067 - 18,784,151	UniSTS
Cytogenetic Map	17	A3.2	UniSTS
Whitehead/MRC_RH	17	236.06	UniSTS
Whitehead/MRC_RH	17	238.46	UniSTS

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357452	Vtbt18_m	vertebral trabecular bone trait 18 (mouse)			Not determined		17	1	20975022	Mouse
1302196	Myaa1_m	modifier of Yaa 1 (mouse)			Not determined		17	1	20975022	Mouse
1357902	Obq19_m	obesity QTL 19 (mouse)			Not determined		17	1	25662076	Mouse
12910982	Pifs2_m	peptide-induced fatal syndrome 2 (mouse)					17	1	26189355	Mouse
1357743	Lith3_m	lithogenic gene 3 (mouse)			Not determined		17	1	26194456	Mouse
1301615	Cfld3_m	cystic fibrosis lung disease 3 (mouse)			Not determined		17	1	27081639	Mouse
1300613	Pcyts4_m	plasmacytoma susceptibility 4 (mouse)			Not determined		17	1	27081639	Mouse
1302100	Circp2_m	circadian photosensitivity 2 (mouse)			Not determined		17	1	29198453	Mouse
12910527	Nrq1a_m	noise-induced hearing loss resistant QTL 1a (mouse)					17	1	29198453	Mouse
12910528	Nrq1_m	noise-induced hearing loss resistant QTL 1 (mouse)					17	1	29198453	Mouse
13524851	Asrq8_m	acoustic startle response 8 (mouse)					17	1	31030170	Mouse
10412276	Leci2_m	leukocyte endothelial cell interactions 2 (mouse)			Not determined		17	3348175	37348299	Mouse
1357680	Idd23_m	insulin dependent diabetes susceptibility 23 (mouse)			Not determined		17	3974890	26401133	Mouse
1300890	Bhr3_m	bronchial hyperresponsiveness 3 (mouse)			Not determined		17	3974890	48866091	Mouse
1301327	Lmr7_m	leishmaniasis resistance 7 (mouse)			Not determined		17	4854752	27715939	Mouse
4141215	Mnic1_m	macronutrient intake, carbohydrate 1 (mouse)			Not determined			4854752	45670266	Mouse
1300706	Alan1_m	alloantigen response 1 (mouse)			Not determined		17	4854752	46469702	Mouse
1357789	Kdnw3_m	kidney weight 3 (mouse)			Not determined		17	4854752	47885665	Mouse
4141272	Tfv1_m	total food volume 1 (mouse)			Not determined			4854752	65637357	Mouse
10043949	Pbft7_m	percent body fat 7 (mouse)			Not determined		17	6893936	40893936	Mouse
4141608	Phl1_m	progressive hearing loss 1 (mouse)			Not determined		17	7875843	29487423	Mouse
1301935	Skull24_m	skull morphology 24 (mouse)			Not determined		17	8584914	42585149	Mouse
1300787	Cd8mts5_m	CD8 memory T cell subset 5 (mouse)			Not determined		17	8584914	42585149	Mouse
1301338	Lmr1_m	leishmaniasis resistance 1 (mouse)			Not determined		17	10081340	86996400	Mouse
1302028	Asbb3_m	autoimmune susceptibility in C57BL/6J and BALB/c 3 (mouse)			Not determined		17	10878119	44878219	Mouse
4142342	Lfnq4_m	lung function QTL 4 (mouse)			Not determined			11206484	39364059	Mouse
4141067	Hbnr2_m	Heligmosomoides bakeri nematode resistance 2 (mouse)			Not determined			11885971	45886119	Mouse
14747010	Mancz14_m	mandible centroid size 14 (mouse)					17	11998184	45998184	Mouse
4142507	Obrq13_m	obesity resistance QTL 13 (mouse)			Not determined			12198329	25076769	Mouse
4142150	Stheal11_m	soft tissue heal 11 (mouse)			Not determined		17	12286211	83361768	Mouse
12904946	Tammq8_m	tibialis anterior muscle mass QTL 8 (mouse)					17	12451787	46451787	Mouse
1558807	Ceat1_m	chronic experimental autoimmune thyroiditis 1 (mouse)			Not determined		17	12636682	26401133	Mouse
13524847	Asrq8a_m	acoustic startle response 8a (mouse)					17	12646961	46646961	Mouse
11081168	Tir7_m	trypanosome infection response 7 (mouse)					17	14123372	48123496	Mouse
1300995	Fembrs4_m	femur breaking strength 4 (mouse)			Not determined		17	15061652	49061760	Mouse
1300914	Pcir4_m	periosteal circumference 4 (mouse)			Not determined		17	15061652	49061760	Mouse
1302070	Tbbmd7_m	total body bone mineral density 7 (mouse)			Not determined		17	15061652	49061760	Mouse
1558886	Lgth9_m	body length 9 (mouse)			Not determined		17	15061652	49061760	Mouse
1302140	Wta4_m	weight adult 4 (mouse)			Not determined		17	16819721	50819843	Mouse
1302152	Skull25_m	skull morphology 25 (mouse)			Not determined		17	16819721	50819843	Mouse
1302038	Radpf1_m	radiation pulmonary fibrosis 1 (mouse)			Not determined		17	16835455	33819843	Mouse
10412083	Sm2_m	susceptibility to Schistosoma mansoni infection 2 (mouse)			Not determined		17	17029943	51030078	Mouse
13452396	Leusq3_m	leucocytosis susceptibility QTL 3 (mouse)					17	17462208	51462345	Mouse
13452399	Leusq6_m	leucocytosis susceptibility QTL 6 (mouse)					17	17462208	51462345	Mouse
10412214	Sxbq3_m	SGC/Knj cross B6 QTL 3 (mouse)			Not determined		17	17462208	51462345	Mouse
1300535	Char3_m	P. chabaudi malaria resistance QTL 3 (mouse)			Not determined		17	17462208	51462345	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	97
Interacting mature miRNAs:	106
Transcripts:	ENSMUST00000003762
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_008215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB005226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC165361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK053726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK138203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW488161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC125424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC125426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS279108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS389038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS409312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS410370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D82964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000003762 ⟹ ENSMUSP00000003762

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	17	18,063,585 - 18,075,450 (-)	Ensembl
GRCm38.p6 Ensembl	17	17,843,323 - 17,855,188 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000232410

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	17	18,067,438 - 18,075,467 (-)	Ensembl
GRCm38.p6 Ensembl	17	17,847,176 - 17,855,205 (-)	Ensembl

RefSeq Acc Id:

NM_008215 ⟹ NP_032241

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	17	18,063,588 - 18,075,450 (-)	NCBI
GRCm38	17	17,843,326 - 17,855,188 (-)	NCBI
MGSCv37	17	17,980,290 - 17,992,152 (-)	RGD
Celera	17	18,784,007 - 18,795,939 (-)	RGD
cM Map	17		ENTREZGENE

Sequence:

show sequence

AGAACAAGACGGAGAAGAGAGAATCCAGGAGGACCCACAGCCATGAGACAGGACATGCCAAAGC
CCTCAGAGGCAGCGCGTTGCTGCTCTGGCCTGGCCAGGCGAGCACTCACGATCATCTTTGCCCT
GCTCATCCTGGGCCTCATGACCTGGGCCTACGCCGCAGGCGTTCCTCTGGCTTCAGATCGCTAT
GGACTCCTGGCCTTTGGCCTCTATGGGGCATTCCTCAGCGCACACCTAGTGGCACAGAGCCTCT
TCGCTTACCTGGAGCACCGAAGGGTGGCAGCGGCTGCGCGGCGCTCCTTGGCGAAGGGGCCCCT
GGATGCGGCCACTGCACGCAGCGTGGCACTCACCATCTCAGCCTACCAAGAGGATCCCGCTTAC
CTGCGCCAGTGCTTGACCTCCGCGCGCGCCTTGCTGTACCCGCACACGAGGTTACGCGTGCTCA
TGGTGGTGGACGGCAACCGCGCTGAGGATCTGTACATGGTGGACATGTTCCGAGAAGTCTTCGC
CGATGAGGACCCCGCCACTTATGTGTGGGATGGCAACTACCATCAGCCCTGGGAACCAGCGGAG
GCTACGGGCGCTGTCGGTGAAGGTGCCTACCGGGAGGTGGAGGCGGAGGACCCCGGGCGGTTGG
CGGTGGAGGCGCTGGTGAGAACACGCAGGTGCGTGTGCGTGGCTCAGCGTTGGGGCGGCAAACG
TGAGGTCATGTACACAGCTTTCAAGGCACTGGGCGACTCCGTGGACTACGTGCAGGTCTGTGAC
TCAGACACAAGACTAGACCCCATGGCACTGCTGGAGCTTGTGCGAGTGTTGGATGAAGACCCCC
GGGTAGGGGCTGTTGGAGGGGATGTGAGGATCCTTAACCCTCTGGACTCCTGGGTCAGCTTCTT
GAGCAGTCTTCGATACTGGGTAGCCTTCAATGTGGAACGAGCTTGTCAGAGCTACTTCCACTGT
GTGTCCTGCATCAGTGGTCCTCTGGGTCTATACAGAAACAATCTCCTGCAGCAGTTCTTGGAGG
CCTGGTACAACCAAAAGTTCCTGGGCACCCACTGCACATTTGGGGATGACAGGCACCTCACCAA
CCGAATGCTTAGCATGGGCTATGCTACCAAGTATACCTCGCGCTCCAGATGCTACTCGGAGACG
CCCTCCTCCTTCCTTCGTTGGTTGAGCCAACAGACCCGCTGGTCCAAATCTTACTTCCGAGAGT
GGCTATACAATGCTCTGTGGTGGCATCGCCACCACGCATGGATGACCTATGAAGCGGTGGTCTC
GGGCCTCTTCCCTTTCTTCGTGGCTGCCACGGTGTTGAGGCTCTTCTATGCAGGGCGCCCGTGG
GCTCTGCTCTGGGTGCTGCTCTGTGTGCAGGGCGTAGCACTGGCAAAGGCAGCCTTTGCAGCCT
GGCTGCGTGGCTGCGTGCGCATGGTGCTGCTGTCACTCTATGCACCACTCTACATGTGCGGCCT
CCTGCCTGCCAAATTCCTAGCGTTGGTTACCATGAATCAAAGTGGTTGGGGTACCTCGGGCCGG
AAGAAACTGGCTGCTAACTACGTCCCCGTGTTGCCCCTGGCACTCTGGGCTCTACTGCTGCTTG
GAGGCCTGGCCCGCAGTGTGGCCCAGGAGGCCAGAGCTGACTGGAGTGGCCCATCCCGAGCAGC
TGAAGCCTACCACCTTGCTGCTGGGGCTGGTGCCTATGTGGCCTACTGGGTGGTAATGTTAACT
ATCTACTGGGTAGGTGTGAGGAGGCTGTGCAGACGTCGGAGCGGTGGTTACCGTGTCCAAGTAT
GAGTCTGGACATGAAGATGCAGCTGAGGGCTCTTAAAGGAGGAGTCCTTGTGAGGCACCCCCTG
GAGTCATGGCTTTCTGGGGACTCAGTTTACCTTCTCTTTGAAATGAGGGAGTTATTTAAGATTC
TTCAATATGGACTGTATTGGAACTCAGATCTAGGTCTCTGGGGAGGGGTAATTTATTGATCAGG
GAGTGGGATTGTAGGACCAGGGCCAGAACGTCTCCATTTTCTCCCTGTTGCTATTTAATGTTTG
TACTGTAAGATTATATAATAAATTTTTTATTTATTTTCTTCCAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_032241	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI25425	(Get FASTA)	NCBI Sequence Viewer
	AAI25427	(Get FASTA)	NCBI Sequence Viewer
	BAA11654	(Get FASTA)	NCBI Sequence Viewer
	BAA25688	(Get FASTA)	NCBI Sequence Viewer
	BAC35492	(Get FASTA)	NCBI Sequence Viewer
	BAE23579	(Get FASTA)	NCBI Sequence Viewer
	CAJ87380	(Get FASTA)	NCBI Sequence Viewer
	CAL40921	(Get FASTA)	NCBI Sequence Viewer
	CAL44785	(Get FASTA)	NCBI Sequence Viewer
	CAL47702	(Get FASTA)	NCBI Sequence Viewer
	EDL20511	(Get FASTA)	NCBI Sequence Viewer
	Q61647	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_032241 ⟸ NM_008215

- UniProtKB:

Q61647 (UniProtKB/Swiss-Prot), Q3UUP6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRQDMPKPSEAARCCSGLARRALTIIFALLILGLMTWAYAAGVPLASDRYGLLAFGLYGAFLSA
HLVAQSLFAYLEHRRVAAAARRSLAKGPLDAATARSVALTISAYQEDPAYLRQCLTSARALLYP
HTRLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAEATGAVGEGAYREVE
AEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQVCDSDTRLDPMALLELV
RVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERACQSYFHCVSCISGPLGLYRNN
LLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKYTSRSRCYSETPSSFLRWLSQQTRW
SKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFVAATVLRLFYAGRPWALLWVLLCVQGVAL
AKAAFAAWLRGCVRMVLLSLYAPLYMCGLLPAKFLALVTMNQSGWGTSGRKKLAANYVPVLPLA
LWALLLLGGLARSVAQEARADWSGPSRAAEAYHLAAGAGAYVAYWVVMLTIYWVGVRRLCRRRS
GGYRVQV

hide sequence

RefSeq Acc Id:

ENSMUSP00000003762 ⟸ ENSMUST00000003762

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q61647-F1-model_v2	AlphaFold	Q61647	1-583	view protein structure

Promoters

RGD ID:

13674862

Promoter ID:

EPDNEW_M21580

Type:

single initiation site

Name:

Has1_1

Description:

Mus musculus hyaluronan synthase 1 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	17	17,855,201 - 17,855,261	EPDNEW

RGD ID:

6849066

Promoter ID:

MM_XEF:3008

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Lung, Spleen

Transcripts:

NM_001112611, NM_001127118, NM_001136212, NM_001164030, NM_001523

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	17	17,987,039 - 17,987,539 (-)	MPROMDB

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:106590	AgrOrtholog
Ensembl Genes	ENSMUSG00000003665	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000003762	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000003762	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.550.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	HAS1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleotide-diphossugar_trans	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:15116	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:106590	ENTREZGENE
NCBI Gene	15116	ENTREZGENE
PANTHER	PTHR22913:SF4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Has1	PhenoGen
Superfamily-SCOP	SSF53448	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	HYAS1_MOUSE	UniProtKB/Swiss-Prot
	Q05A37_MOUSE	UniProtKB/TrEMBL
	Q3UUP6	ENTREZGENE, UniProtKB/TrEMBL
	Q61647	ENTREZGENE
	Q8BPN0_MOUSE	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-14	Has1	hyaluronan synthase 1		hyaluronan synthase1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message