Il23a (interleukin 23, alpha subunit p19)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Il23a (interleukin 23, alpha subunit p19) Mus musculus

Analyze

Symbol:

Il23a

Name:

interleukin 23, alpha subunit p19

RGD ID:

1552166

MGI Page

MGI

Description:

Contributes to interleukin-23 receptor binding activity. Involved in several processes, including positive regulation of defense response to virus by host; positive regulation of immune response; and positive regulation of neutrophil chemotaxis. Localizes to interleukin-23 complex. Is expressed in decidua; decidua basalis; embryo; and extraembryonic component. Orthologous to human IL23A (interleukin 23 subunit alpha); PARTICIPATES IN interleukin-23 signaling pathway; Jak-Stat signaling pathway; rheumatoid arthritis pathway; INTERACTS WITH (-)-epigallocatechin 3-gallate; 2,2',4,4',5,5'-hexachlorobiphenyl; 2,2',5,5'-tetrachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

IL-; IL-23; IL-23 subunit alpha; IL-23-A; IL-23p19; interleukin-23 subunit alpha; interleukin-23 subunit p19; p1; p19

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL23A (interleukin 23 subunit alpha)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Il23a (interleukin 23 subunit alpha)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Il23a (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL23A (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IL23A (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il23a (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IL23A (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	IL23A (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Il23a (interleukin 23 subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Il23a (interleukin 23 subunit alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	IL23A (interleukin 23 subunit alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	128,132,009 - 128,133,953 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	10	128,132,008 - 128,134,621 (-)	Ensembl
GRCm38	10	128,296,140 - 128,298,084 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	128,296,139 - 128,298,752 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	127,733,196 - 127,735,140 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	10	127,699,089 - 127,701,033 (-)	NCBI			mm8
Celera	10	130,684,464 - 130,686,407 (-)	NCBI		Celera
Cytogenetic Map	10	D3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Amebic Liver Abscess (IEP,IMP)

Animal Toxoplasmosis (IMP)

Bovine Tuberculosis (IMP)

campylobacteriosis (IMP)

Chagas Cardiomyopathy (IMP)

Chagas disease (IMP)

Clostridium difficile colitis (IMP)

cryptococcosis (IMP)

cutaneous leishmaniasis (IMP)

Experimental Allergic Asthma (IMP)

Experimental Colitis (IEP)

gastric ulcer (IMP)

herpes simplex virus keratitis (IEP)

Klebsiella pneumonia (IMP)

listeriosis (IMP)

Middle East respiratory syndrome (HEP)

oral candidiasis (IMP)

pneumocystosis (IMP)

psoriasis (ISO)

pulmonary tuberculosis (IEP,IMP)

rheumatoid arthritis (ISO)

severe acute respiratory syndrome (HEP)

tularemia (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (ISO)

(-)-epigallocatechin 3-gallate (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2-hydroxypropanoic acid (ISO)

2-tert-butylhydroquinone (ISO)

4-hydroxy-N,1-dimethyl-2-oxo-N-phenyl-3-quinolinecarboxamide (EXP)

4-nitroquinoline N-oxide (EXP)

6alpha-methylprednisolone (ISO)

ammonium chloride (ISO)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsenite(3-) (ISO)

arsenous acid (EXP)

azathioprine (ISO)

benzalkonium chloride (EXP)

benzo[a]pyrene (EXP,ISO)

berberine (EXP)

beta-D-glucan (ISO)

beta-naphthoflavone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bortezomib (ISO)

bucladesine (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calciol (EXP)

carbamazepine (EXP)

carbon nanotube (EXP,ISO)

celastrol (EXP)

cisplatin (EXP,ISO)

colforsin daropate hydrochloride (EXP)

copper(II) sulfate (ISO)

cyanidin cation (EXP,ISO)

cyclophosphamide (EXP)

D-penicillamine (EXP)

decabromodiphenyl ether (ISO)

deoxynivalenol (EXP)

dextran sulfate (EXP,ISO)

diarsenic trioxide (EXP)

diclofenac (ISO)

dimethyl sulfoxide (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

endosulfan (ISO)

estriol (EXP)

ethanol (EXP)

ethyl methanesulfonate (ISO)

ferulic acid (EXP)

flutamide (ISO)

folic acid (EXP)

fragrance (ISO)

furan (ISO)

hydroquinone (EXP)

hydroquinone O-beta-D-glucopyranoside (ISO)

hydroxychloroquine (EXP)

imiquimod (EXP)

levamisole (EXP)

linuron (EXP)

lipopolysaccharide (EXP,ISO)

manganese(II) chloride (ISO)

medroxyprogesterone acetate (ISO)

melphalan (EXP)

methotrexate (EXP,ISO)

misoprostol (ISO)

muramyl dipeptide (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel sulfate (ISO)

nimesulide (EXP)

ozone (ISO)

paracetamol (EXP)

PCB138 (EXP)

peptidoglycan (ISO)

phenytoin (EXP)

phorbol 12,13-dibutanoate (ISO)

phytoestrogen (EXP)

pioglitazone (EXP)

piroxicam (ISO)

potassium dichromate (EXP)

prednisolone (ISO)

prostaglandin E1 (EXP)

prostaglandin E2 (EXP,ISO)

rac-lactic acid (ISO)

resiquimod (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP)

silicon dioxide (EXP,ISO)

silver atom (EXP)

silver(0) (EXP)

simvastatin (ISO)

sodium arsenite (EXP)

sodium aurothiomalate (ISO)

sodium sulfate (EXP)

tacrolimus hydrate (EXP)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

tofacitinib (EXP)

triptonide (EXP)

vincristine (ISO)

wortmannin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to Gram-negative bacterium (ISO)

defense response to virus (IEA)

immune response (IEA)

immune system process (IEA)

inflammatory response (IEA)

innate immune response (IEA)

negative regulation of interleukin-10 production (ISO)

positive regulation of activated T cell proliferation (ISO)

positive regulation of activation of Janus kinase activity (IBA,ISO)

positive regulation of defense response to virus by host (IDA,ISO)

positive regulation of granulocyte macrophage colony-stimulating factor production (ISO)

positive regulation of interferon-gamma production (ISO)

positive regulation of interleukin-10 production (ISO)

positive regulation of interleukin-12 production (ISO)

positive regulation of interleukin-17 production (ISO)

positive regulation of memory T cell differentiation (IDA)

positive regulation of natural killer cell proliferation (ISO)

positive regulation of neutrophil chemotaxis (IDA)

positive regulation of NK T cell activation (ISO)

positive regulation of NK T cell proliferation (ISO)

positive regulation of osteoclast differentiation (ISO)

positive regulation of T cell mediated cytotoxicity (IDA)

positive regulation of T cell proliferation (IBA,ISO)

positive regulation of T-helper 1 type immune response (IDA,ISO)

positive regulation of T-helper 17 cell lineage commitment (IBA,IDA)

positive regulation of T-helper 17 type immune response (IDA)

positive regulation of transcription by RNA polymerase II (IGI)

positive regulation of tumor necrosis factor production (ISO)

positive regulation of tyrosine phosphorylation of STAT protein (ISO)

regulation of tyrosine phosphorylation of STAT protein (ISO)

T cell proliferation (IDA)

tissue remodeling (IEA)

Cellular Component

extracellular region (IEA,TAS)

extracellular space (IDA)

interleukin-23 complex (IBA,IDA,ISO)

Molecular Function

cytokine activity (IEA)

interleukin-23 receptor binding (IPI,ISO)

protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

interleukin-23 signaling pathway (ISO)

Jak-Stat signaling pathway (IEA)

rheumatoid arthritis pathway (IEA)

tuberculosis pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal CD4-positive, alpha-beta T cell physiology (IAGP)

abnormal CD8-positive, alpha beta T cell morphology (IAGP)

abnormal CD8-positive, alpha-beta T cell physiology (IAGP)

abnormal circulating interleukin level (IAGP)

abnormal granulocyte physiology (IAGP)

abnormal interleukin level (IAGP)

abnormal macrophage physiology (IAGP)

abnormal memory T cell physiology (IAGP)

decreased activated T cell number (IAGP)

decreased gamma-delta T cell number (IAGP)

decreased IgA level (IAGP)

decreased IgG2a level (IAGP)

decreased immunoglobulin level (IAGP)

decreased incidence of tumors by chemical induction (IAGP)

decreased interferon-gamma secretion (IAGP)

decreased interleukin-17 secretion (IAGP)

decreased leukocyte cell number (IAGP)

decreased neutrophil cell number (IAGP)

decreased physiological sensitivity to xenobiotic (IAGP)

decreased susceptibility to experimental autoimmune encephalomyelitis (IAGP)

decreased susceptibility to induced colitis (IAGP)

decreased T cell number (IAGP)

decreased T cell proliferation (IAGP)

decreased tumor growth/size (IAGP)

dermatitis (IAGP)

granulomatous inflammation (IAGP)

increased circulating interleukin-17 level (IAGP)

increased sensitivity to xenobiotic induced morbidity/mortality (IAGP)

increased susceptibility to bacterial infection (IAGP)

increased susceptibility to bacterial infection induced morbidity/mortality (IAGP)

increased susceptibility to induced colitis (IAGP)

no abnormal phenotype detected (IEA)

References

References - curated


1.	Bereswill S, etal., PLoS One. 2016 Jun 20;11(6):e0158020. doi: 10.1371/journal.pone.0158020. eCollection 2016.
2.	Broberg EK, etal., J Interferon Cytokine Res. 2002 Jun;22(6):641-51. doi: 10.1089/10799900260100123.
3.	Chackerian AA, etal., Infect Immun. 2006 Nov;74(11):6092-9. doi: 10.1128/IAI.00621-06. Epub 2006 Aug 21.
4.	Conti HR, etal., J Exp Med. 2009 Feb 16;206(2):299-311. doi: 10.1084/jem.20081463. Epub 2009 Feb 9.
5.	Cooper AM, etal., J Immunol. 2002 Feb 1;168(3):1322-7. doi: 10.4049/jimmunol.168.3.1322.
6.	Cruz A, etal., J Exp Med. 2010 Aug 2;207(8):1609-16. doi: 10.1084/jem.20100265. Epub 2010 Jul 12.
7.	Dietze-Schwonberg K, etal., Exp Dermatol. 2018 Jan;27(1):101-103. doi: 10.1111/exd.13455. Epub 2017 Dec 6.
8.	Ding H, etal., PLoS One. 2013 Jul 11;8(7):e69384. doi: 10.1371/journal.pone.0069384. Print 2013.
9.	Erdmann H, etal., Immunobiology. 2013 Jun;218(6):910-23. doi: 10.1016/j.imbio.2012.10.005. Epub 2012 Oct 26.
10.	Happel KI, etal., Alcohol Clin Exp Res. 2006 Jul;30(7):1200-7. doi: 10.1111/j.1530-0277.2006.00144.x.
11.	Happel KI, etal., J Exp Med. 2005 Sep 19;202(6):761-9. doi: 10.1084/jem.20050193. Epub 2005 Sep 12.
12.	Heimesaat MM, etal., Gut Pathog. 2016 Jul 6;8:21. doi: 10.1186/s13099-016-0106-4. eCollection 2016.
13.	Indramohan M, etal., Infect Immun. 2012 Dec;80(12):4099-105. doi: 10.1128/IAI.00589-12. Epub 2012 Sep 10.
14.	Khader SA, etal., J Immunol. 2005 Jul 15;175(2):788-95. doi: 10.4049/jimmunol.175.2.788.
15.	Kitada S, etal., J Exp Med. 2017 May 1;214(5):1313-1331. doi: 10.1084/jem.20161076. Epub 2017 Mar 29.
16.	Kleinschek MA, etal., J Immunol. 2006 Jan 15;176(2):1098-106. doi: 10.4049/jimmunol.176.2.1098.
17.	Kurtz SL, etal., PLoS One. 2014 Oct 8;9(10):e109898. doi: 10.1371/journal.pone.0109898. eCollection 2014.
18.	Lieberman LA, etal., J Immunol. 2004 Aug 1;173(3):1887-93. doi: 10.4049/jimmunol.173.3.1887.
19.	McDermott AJ, etal., Immunology. 2016 Jan;147(1):114-24. doi: 10.1111/imm.12545. Epub 2015 Dec 2.
20.	Meeks KD, etal., J Immunol. 2009 Dec 15;183(12):8026-34. doi: 10.4049/jimmunol.0901588.
21.	MGD data from the GO Consortium
22.	MGD IEA
23.	Noll J, etal., J Hepatol. 2016 May;64(5):1147-1157. doi: 10.1016/j.jhep.2016.01.013. Epub 2016 Jan 22.
24.	Ogawa R, etal., Allergol Int. 2015 Sep;64 Suppl:S24-9. doi: 10.1016/j.alit.2015.04.005. Epub 2015 May 16.
25.	Okada Y, etal., Clin Exp Immunol. 2013 Dec;174(3):459-71. doi: 10.1111/cei.12200.
26.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
27.	Peltoniemi J, etal., Clin Exp Immunol. 2004 Aug;137(2):305-12. doi: 10.1111/j.1365-2249.2004.02528.x.
28.	Peng J, etal., Cell Res. 2010 Jan;20(1):62-71. Epub 2009 Nov 24.
29.	Pipeline to import KEGG annotations from KEGG into RGD
30.	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
31.	RGD automated import pipeline
32.	RGD automated import pipeline for gene-chemical interactions
33.	Rudner XL, etal., Infect Immun. 2007 Jun;75(6):3055-61. doi: 10.1128/IAI.01329-06. Epub 2007 Apr 2.
34.	Szymczak WA, etal., Am J Pathol. 2012 Apr;180(4):1547-59. doi: 10.1016/j.ajpath.2011.12.038. Epub 2012 Feb 16.
35.	Teixeira-Coelho M, etal., Int Immunol. 2011 Feb;23(2):89-96. doi: 10.1093/intimm/dxq459. Epub 2010 Dec 14.
36.	Yao Z, etal., Aging (Albany NY). 2020 May 2;12(9):7639-7651. doi: 10.18632/aging.103101. Epub 2020 May 2.

Additional References at PubMed

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11114383	PMID:11217851	PMID:11390512	PMID:12417590	PMID:12477932	PMID:12610626	PMID:12646495	PMID:12847224	PMID:14566340
PMID:14568135	PMID:14610273	PMID:14662908	PMID:14688363	PMID:14978083	PMID:15489334	PMID:15657292	PMID:16141072	PMID:16141073	PMID:16339539	PMID:16648837	PMID:16670770
PMID:16670771	PMID:16688182	PMID:16698929	PMID:16751361	PMID:16818672	PMID:16849446	PMID:16919486	PMID:16920909	PMID:16982811	PMID:17030948	PMID:17030949	PMID:17052755
PMID:17071720	PMID:17088434	PMID:17142310	PMID:17142769	PMID:17200411	PMID:17277169	PMID:17294405	PMID:17351619	PMID:17548652	PMID:17804196	PMID:17897860	PMID:17899546
PMID:17919942	PMID:17982049	PMID:18250458	PMID:18264109	PMID:18311793	PMID:18336386	PMID:18375954	PMID:18391061	PMID:18400195	PMID:18490716	PMID:18566439	PMID:18570589
PMID:18579699	PMID:18600259	PMID:18606706	PMID:18698497	PMID:18762568	PMID:18787221	PMID:18799693	PMID:18802055	PMID:18818389	PMID:18831919	PMID:18832731	PMID:18955477
PMID:18958885	PMID:18978771	PMID:19017979	PMID:19039774	PMID:19059877	PMID:19060952	PMID:19185846	PMID:19200759	PMID:19201478	PMID:19273625	PMID:19289819	PMID:19299021
PMID:19339380	PMID:19342674	PMID:19357249	PMID:19357708	PMID:19380813	PMID:19409487	PMID:19414740	PMID:19469707	PMID:19501566	PMID:19542449	PMID:19570828	PMID:19592489
PMID:19624579	PMID:19625643	PMID:19635858	PMID:19648929	PMID:19657089	PMID:19666510	PMID:19727119	PMID:19853481	PMID:19890042	PMID:19995958	PMID:20017902	PMID:20083652
PMID:20130220	PMID:20131264	PMID:20228197	PMID:20360853	PMID:20364087	PMID:20382845	PMID:20393462	PMID:20404142	PMID:20404153	PMID:20408896	PMID:20421647	PMID:20434372
PMID:20458705	PMID:20600778	PMID:20624950	PMID:20732640	PMID:20832339	PMID:20921529	PMID:21036146	PMID:21093318	PMID:21097874	PMID:21135172	PMID:21148126	PMID:21169541
PMID:21172868	PMID:21194981	PMID:21278737	PMID:21282337	PMID:21289639	PMID:21304519	PMID:21321105	PMID:21336274	PMID:21372631	PMID:21402701	PMID:21516111	PMID:21670317
PMID:21741931	PMID:21746859	PMID:21807912	PMID:21858022	PMID:21873635	PMID:21931625	PMID:21953641	PMID:22003199	PMID:22005301	PMID:22025517	PMID:22089030	PMID:22101830
PMID:22202675	PMID:22287718	PMID:22297634	PMID:22306017	PMID:22355103	PMID:22387269	PMID:22519587	PMID:22591694	PMID:22624013	PMID:22753938	PMID:22772566	PMID:22792286
PMID:22799166	PMID:22972933	PMID:22977257	PMID:23034650	PMID:23050010	PMID:23064362	PMID:23086919	PMID:23178247	PMID:23180821	PMID:23200826	PMID:23200827	PMID:23233727
PMID:23319736	PMID:23334414	PMID:23341605	PMID:23460846	PMID:23469022	PMID:23475182	PMID:23528817	PMID:23554941	PMID:23623497	PMID:23677049	PMID:23752068	PMID:23754427
PMID:23781104	PMID:23843079	PMID:23913046	PMID:23940256	PMID:24019552	PMID:24040208	PMID:24238108	PMID:24283842	PMID:24292977	PMID:24293139	PMID:24300243	PMID:24343647
PMID:24379290	PMID:24387596	PMID:24434636	PMID:24442441	PMID:24453427	PMID:24569709	PMID:24664521	PMID:24829419	PMID:24978886	PMID:25001511	PMID:25024136	PMID:25033445
PMID:25043027	PMID:25050810	PMID:25160819	PMID:25200028	PMID:25201978	PMID:25249168	PMID:25274297	PMID:25305492	PMID:25348165	PMID:25371211	PMID:25452564	PMID:25600958
PMID:25637493	PMID:25639230	PMID:25761673	PMID:25838550	PMID:25902485	PMID:25908663	PMID:25959063	PMID:25965582	PMID:26006013	PMID:26160380	PMID:26189370	PMID:26216045
PMID:26223651	PMID:26239416	PMID:26242598	PMID:26358260	PMID:26377898	PMID:26431947	PMID:26511769	PMID:26647405	PMID:26660726	PMID:26912904	PMID:26993035	PMID:27019190
PMID:27043160	PMID:27111864	PMID:27189410	PMID:27193261	PMID:27297018	PMID:27341090	PMID:27351934	PMID:27365293	PMID:27369778	PMID:27384869	PMID:27540765	PMID:27551155
PMID:27634762	PMID:27729335	PMID:27795421	PMID:27820809	PMID:27864285	PMID:27956175	PMID:27956525	PMID:27984001	PMID:27995603	PMID:28087239	PMID:28282579	PMID:28290522
PMID:28299442	PMID:28377495	PMID:28555647	PMID:28646040	PMID:28690333	PMID:28855306	PMID:29187586	PMID:29364878	PMID:29386115	PMID:29398651	PMID:29524223	PMID:29602153
PMID:29615652	PMID:29650963	PMID:29760082	PMID:29870687	PMID:29909020	PMID:29925696	PMID:29950727	PMID:30018073	PMID:30292634	PMID:30307739	PMID:30355616	PMID:30389414
PMID:30427069	PMID:31020341	PMID:31132747	PMID:31154574	PMID:31158699	PMID:31166866	PMID:31230747	PMID:31350179	PMID:31707227	PMID:31776355	PMID:32203518	PMID:32427877
PMID:32554431	PMID:32632165	PMID:33259477

Genomics

Comparative Map Data

Il23a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	128,132,009 - 128,133,953 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	10	128,132,008 - 128,134,621 (-)	Ensembl
GRCm38	10	128,296,140 - 128,298,084 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	128,296,139 - 128,298,752 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	127,733,196 - 127,735,140 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	10	127,699,089 - 127,701,033 (-)	NCBI			mm8
Celera	10	130,684,464 - 130,686,407 (-)	NCBI		Celera
Cytogenetic Map	10	D3	NCBI

IL23A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	12	56,334,174 - 56,340,410 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	12	56,334,159 - 56,340,410 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	12	56,732,668 - 56,734,194 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	55,018,930 - 55,020,461 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	12	55,018,929 - 55,020,460	NCBI
Celera	12	56,386,015 - 56,387,546 (+)	NCBI
Cytogenetic Map	12	q13.3	NCBI
HuRef	12	53,771,325 - 53,772,856 (+)	NCBI		HuRef
CHM1_1	12	56,700,047 - 56,701,578 (+)	NCBI		CHM1_1

Il23a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	721,809 - 723,923 (-)	NCBI
Rnor_6.0 Ensembl	7	2,710,609 - 2,712,723 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	7	2,710,609 - 2,712,723 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	7	2,689,128 - 2,691,242 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	1,584,112 - 1,586,226 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	7	1,584,111 - 1,586,226 (-)	NCBI
Celera	7	597,260 - 599,374 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

Il23a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	3,947,803 - 3,949,312 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	3,946,964 - 3,949,180 (+)	NCBI	ChiLan1.0	ChiLan1.0

IL23A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	32,828,902 - 32,830,621 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	32,828,902 - 32,830,617 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	32,575,321 - 32,576,856 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

IL23A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	635,384 - 640,715 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	638,719 - 640,359 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	700,688 - 704,049 (+)	NCBI
ROS_Cfam_1.0	10	646,091 - 649,452 (+)	NCBI
UMICH_Zoey_3.1	10	623,343 - 626,704 (+)	NCBI
UNSW_CanFamBas_1.0	10	866,496 - 869,858 (+)	NCBI
UU_Cfam_GSD_1.0	10	990,220 - 993,580 (+)	NCBI

Il23a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	58,124,372 - 58,126,957 (-)	NCBI
SpeTri2.0	NW_004936646	743,630 - 745,998 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL23A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	21,732,165 - 21,734,267 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	21,732,416 - 21,733,981 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

IL23A
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	52,289,486 - 52,296,735 (+)	NCBI
ChlSab1.1 Ensembl	11	52,295,106 - 52,297,244 (+)	Ensembl

Il23a
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624802	11,662,851 - 11,664,444 (-)	NCBI

Position Markers

PMC182190P1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	128,297,078 - 128,297,971	UniSTS	GRCm38
MGSCv37	10	127,734,134 - 127,735,027	UniSTS	GRCm37
Celera	10	130,685,401 - 130,686,294	UniSTS
Cytogenetic Map	10	D3	UniSTS

Il23a

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	128,297,078 - 128,297,555	UniSTS	GRCm38
Celera	10	130,685,401 - 130,685,878	UniSTS
Cytogenetic Map	10	D3	UniSTS
cM Map	10	76.51	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4141153	Ltgq2_m	liver triglyceride QTL 2 (mouse)			Not determined			108680038	130694993	Mouse
1357482	Nhdlq4_m	non-HDL QTL 4 (mouse)			Not determined		10	105205399	130694993	Mouse
1301895	Exq1_m	exploratory and excitability QTL 1 (mouse)			Not determined		10	103011947	130694993	Mouse
11040593	Lmr5e_m	leishmaniasis resistance 5e (mouse)					10	99384730	130694993	Mouse
12911221	Frct3d_m	fear conditioning traits 3d (mouse)					10	127839705	129631127	Mouse
11040595	Lmr5c_m	leishmaniasis resistance 5c (mouse)					10	99384730	130694993	Mouse
12904001	Opfaq10_m	open field activity QTL 10 (mouse)					10	125797802	129630506	Mouse
4141361	Cfmq3_m	cystic fibrosis modifier QTL 3 (mouse)			Not determined		10	101661259	130694993	Mouse
1300679	Nociq2_m	nociceptive sensitivity inflammatory QTL 2 (mouse)			Not determined		10	105205399	130694993	Mouse
11040594	Lmr5f_m	leishmaniasis resistance 5f (mouse)					10	105343808	130694993	Mouse
1301901	Im5_m	immunoregulatory 5 (mouse)			Not determined		10	101661259	130694993	Mouse
1301968	Estq4_m	estradiol regulated response QTL 4 (mouse)			Not determined		10	101150611	130694993	Mouse
4141402	T2dm1sa_m	type 2 diabetes mellitus 1 in SMXA RI mice (mouse)			Not determined			97922739	130694993	Mouse
27226772	Tibl13_m	tibia length 13, 10 week (mouse)					10	19000000	129800000	Mouse
12911219	Frct3b_m	fear conditioning traits 3b (mouse)					10	127839705	129631127	Mouse
12880413	V125Dq9_m	vitamin D active form serum level QTL 9 (mouse)					10	97700000	130694993	Mouse
11049563	Lmr25a_m	leishmaniasis resistance 25a (mouse)					10	108739225	130694993	Mouse
11040597	Lmr5a_m	leishmaniasis resistance 5a (mouse)					10	99384730	130694993	Mouse
12911218	Frct3a_m	fear conditioning traits 3a (mouse)					10	122950065	129631127	Mouse
12904000	Opfaq7_m	open field activity QTL 7 (mouse)					10	127910449	129630506	Mouse
1357744	Cfbw4_m	cystic fibrosis body weight 4 (mouse)			Not determined		10	101150611	130694993	Mouse
11533921	Mvb2_m	modifier of vibrator 2 (mouse)					10	97381196	130694993	Mouse
12879490	Frct3_m	fear conditioning traits 3 (mouse)					10	122950065	129631127	Mouse
27226764	Tibl19_m	tibia length 19, 16 week (mouse)					10	39300000	129800000	Mouse
14746996	Manh69_m	mandible shape 69 (mouse)					10	104927733	130694993	Mouse
11533919	Mvb4_m	modifier of vibrator 4 (mouse)					3	97381196	130694993	Mouse
14696727	Kidrq2_m	kidney weight, right QTL 2 (mouse)					10	103066603	130694993	Mouse
4142461	Bmd25_m	bone mineral density 25 (mouse)			Not determined		10	97381196	130694993	Mouse
4141487	Tgq21_m	triglyceride QTL 21 (mouse)			Not determined			104274116	130694993	Mouse
4141007	Obrq10_m	obesity resistance QTL 10 (mouse)			Not determined			103407822	130694993	Mouse
26884405	Huml2_m	humerus length 2, 5 week (mouse)					10	69900000	132500000	Mouse
1300678	Leg2_m	longevity extending gene 2 (mouse)			Not determined		10	102671003	130694993	Mouse
1357544	Vtbt10_m	vertebral trabecular bone trait 10 (mouse)			Not determined		10	97381196	130694993	Mouse
27095911	Pglq15_m	pelvic girdle length QTL 15, 16 week (mouse)					10	39300000	129800000	Mouse
12911220	Frct3c_m	fear conditioning traits 3c (mouse)					10	122950065	129631127	Mouse
1302200	Sle12_m	systematic lupus erythematosus susceptibility 12 (mouse)			Not determined		10	105205399	130694993	Mouse
11039496	Ltpr5b_m	Leishmania tropica response 5b (mouse)					10	108739225	130694993	Mouse
11049570	Lmr25b_m	leishmaniasis resistance 25b (mouse)					10	108739225	130694993	Mouse
4142089	Obrq9_m	obesity resistance QTL 9 (mouse)			Not determined			108680038	130694993	Mouse
11040596	Lmr5d_m	leishmaniasis resistance 5d (mouse)					10	105343808	130694993	Mouse
11041664	Lmr25_m	leishmaniasis resistance 25 (mouse)					10	108739225	130694993	Mouse
11040598	Lmr5b_m	leishmaniasis resistance 5b (mouse)					10	105343808	130694993	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	203
Count of miRNA genes:	174
Interacting mature miRNAs:	189
Transcripts:	ENSMUST00000026449
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC135859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF301619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK043894	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC019953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CQ878369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FB701193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HC026803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000026449 ⟹ ENSMUSP00000026449

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	10	128,296,139 - 128,298,084 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000218109

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	10	128,296,662 - 128,298,752 (-)	Ensembl

RefSeq Acc Id:

NM_031252 ⟹ NP_112542

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	128,132,009 - 128,133,953 (-)	NCBI
GRCm38	10	128,296,140 - 128,298,084 (-)	ENTREZGENE
MGSCv37	10	127,733,196 - 127,735,140 (-)	RGD
Celera	10	130,684,464 - 130,686,407 (-)	RGD
cM Map	10		ENTREZGENE

Sequence:

show sequence

CGCTTAGAAGTCGGACTACAGAGTTAGACTCAGAACCAAAGGAGGTGGATAGGGGGTCCACAGG
CCTGGTGCAGATCACAGAGCCAGCCAGATCTGAGAAGCAGGGAACAAGATGCTGGATTGCAGAG
CAGTAATAATGCTATGGCTGTTGCCCTGGGTCACTCAGGGCCTGGCTGTGCCTAGGAGTAGCAG
TCCTGACTGGGCTCAGTGCCAGCAGCTCTCTCGGAATCTCTGCATGCTAGCCTGGAACGCACAT
GCACCAGCGGGACATATGAATCTACTAAGAGAAGAAGAGGATGAAGAGACTAAAAATAATGTGC
CCCGTATCCAGTGTGAAGATGGTTGTGACCCACAAGGACTCAAGGACAACAGCCAGTTCTGCTT
GCAAAGGATCCGCCAAGGTCTGGCTTTTTATAAGCACCTGCTTGACTCTGACATCTTCAAAGGG
GAGCCTGCTCTACTCCCTGATAGCCCCATGGAGCAACTTCACACCTCCCTACTAGGACTCAGCC
AACTCCTCCAGCCAGAGGATCACCCCCGGGAGACCCAACAGATGCCCAGCCTGAGTTCTAGTCA
GCAGTGGCAGCGCCCCCTTCTCCGTTCCAAGATCCTTCGAAGCCTCCAGGCCTTTTTGGCCATA
GCTGCCCGGGTCTTTGCCCACGGAGCAGCAACTCTGACTGAGCCCTTAGTGCCAACAGCTTAAG
GATGCCCAGGTTCCCATGGCTACCATGATAAGACTAATCTATCAGCCCAGACATCTACCAGTTA
ATTAACCCATTAGGACTTGTGCTGTTCTTGTTTTGTTTGTTTTGCGTGAAGGGCAAGGACACCA
TTATTAAAGAGAAAAGAAACAAACCCCAGAGCAGGCAGCTGGCTAGAGAAAGGAGCTGGAGAAG
AAGAATAAAGTCTCGAGCCCTTGGCCTTGGAAGCGGGCAAGCAGCTGCGTGGCCTGAGGGGAAG
GGGGCGGTGGCATCGAGAAACTGTGAGAAAACCCAGAGCATCAGAAAAAGTGAGCCCAGGCTTT
GGCCATTATCTGTAAGAAAAACAAGAAAAGGGGAACATTATACTTTCCTGGGTGGCTCAGGGAA
ATGTGCAGATGCACAGTACTCCAGACAGCAGCTCTGTACCTGCCTGCTCTGTCCCTCAGTTCTA
ACAGAATCTAGTCACTAAGAACTAACAGGACTACCAATACGAACTGACAAATACTACCACTATG
ACCTGTGACAAAGCTGCATATTTATTAAGTGGGAAGGGAACTTTTGATATTATTTATCCTTGTA
ACAGTATAGATGATGGTTATTTATTCTATTTATAAGGAATTATGTATTTTTTTTTTCAATAAAG
ATTTATTTATGTGGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_112542	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG37231	(Get FASTA)	NCBI Sequence Viewer
	AAH19953	(Get FASTA)	NCBI Sequence Viewer
	CAH59603	(Get FASTA)	NCBI Sequence Viewer
	CAS03313	(Get FASTA)	NCBI Sequence Viewer
	CBH19860	(Get FASTA)	NCBI Sequence Viewer
	EDL24554	(Get FASTA)	NCBI Sequence Viewer
	Q9EQ14	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_112542 ⟸ NM_031252
- Peptide Label:	precursor
- UniProtKB:	Q9EQ14 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEE TKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTS LLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPL VPTA hide sequence

RefSeq Acc Id:

ENSMUSP00000026449 ⟸ ENSMUST00000026449

Promoters

RGD ID:

6819463

Promoter ID:

MM_KWN:5982

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell

Transcripts:

NM_031252

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	10	127,734,911 - 127,735,912 (-)	MPROMDB

RGD ID:

8673596

Promoter ID:

EPDNEW_M14829

Type:

single initiation site

Name:

Il23a_1

Description:

Mus musculus interleukin 23, alpha subunit p19 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	10	128,298,096 - 128,298,156	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1932410	AgrOrtholog
Ensembl Genes	ENSMUSG00000025383	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000026449	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000026449	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	4_helix_cytokine-like_core	UniProtKB/Swiss-Prot
	IL-23_alpha	UniProtKB/Swiss-Prot
KEGG Report	mmu:83430	UniProtKB/Swiss-Prot
MGD	MGI:1932410	ENTREZGENE
NCBI Gene	83430	ENTREZGENE
PANTHER	PTHR15947	UniProtKB/Swiss-Prot
Pfam	IL23	UniProtKB/Swiss-Prot
PhenoGen	Il23a	PhenoGen
Superfamily-SCOP	SSF47266	UniProtKB/Swiss-Prot
UniProt	IL23A_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)