Rln3 (relaxin 3) - Rat Genome Database

Name: Rln3
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rln3 (relaxin 3) Mus musculus

Analyze

Symbol:

Rln3

Name:

relaxin 3

RGD ID:

1551268

MGI Page

MGI

Description:

Predicted to have G protein-coupled receptor binding activity. Predicted to localize to extracellular region. Is expressed in brain; ovary; and testis. Orthologous to human RLN3 (relaxin 3); INTERACTS WITH 1,2-dichloroethane; genistein; hydrogen sulfide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Also known as:

insl7; insulin-like 7; insulin-like peptide 7; insulin-like peptide INSL7; M3; prorelaxin M3; relaxin-3

RGD Orthologs

Human

Rat

Chinchilla

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RLN3 (relaxin 3)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Rln3 (relaxin 3)	HGNC	Treefam, EggNOG, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Rln3 (relaxin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RLN3 (relaxin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rln3 (relaxin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RLN3 (relaxin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	RLN3 (relaxin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rln3 (relaxin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Rln3 (relaxin 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	RLN3 (relaxin 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	rln3b (relaxin 3b)	Alliance	DIOPT (PhylomeDB\|ZFIN)
Danio rerio (zebrafish):	rln3a (relaxin 3a)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam\|ZFIN)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	84,769,696 - 84,771,608 (-)	NCBI	GRCm39		mm39
GRCm38	8	84,043,067 - 84,044,979 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,042,929 - 84,045,000 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	86,566,966 - 86,568,878 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	86,933,172 - 86,935,084 (-)	NCBI			mm8
Celera	8	88,337,588 - 88,339,500 (-)	NCBI		Celera
Cytogenetic Map	8	C2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hyperplasia (ISO)

Myocardial Ischemia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (EXP)

ammonium chloride (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

decabromodiphenyl ether (ISO)

fenvalerate (ISO)

furan (ISO)

genistein (EXP)

hydrogen sulfide (EXP)

isoprenaline (ISO)

thioacetamide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

extracellular region (TAS)

Molecular Function

G protein-coupled receptor binding (IBA,ISO)

hormone activity (IEA)

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal anxiety-related response (IEA)

abnormal behavior (IEA)

abnormal bone mineralization (IEA)

abnormal coat/hair pigmentation (IEA)

abnormal locomotor activation (IEA)

abnormal paired-pulse inhibition (IAGP)

abnormal social investigation (IAGP)

behavioral despair (IAGP)

decreased anxiety-related response (IAGP)

decreased body size (IAGP)

decreased body weight (IAGP)

decreased circulating insulin level (IAGP)

decreased circulating leptin level (IAGP)

decreased mesenteric fat pad weight (IAGP)

decreased subcutaneous adipose tissue amount (IAGP)

decreased susceptibility to diet-induced obesity (IAGP)

decreased total body fat amount (IAGP)

hypoactivity (IAGP)

increased adiponectin level (IAGP)

increased startle reflex (IAGP)

References

References - curated


1.	Burazin TC, etal., J Neurochem 2002 Sep;82(6):1553-7.
2.	MGD data from the GO Consortium
3.	RGD automated import pipeline
4.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11689565	PMID:12686464	PMID:14610273	PMID:16411781	PMID:16602821	PMID:17170214	PMID:18831067	PMID:19416195	PMID:19416196	PMID:19416199	PMID:20138959	PMID:20737598
PMID:21873635	PMID:21887138	PMID:21899720	PMID:24194600	PMID:24640569	PMID:24640570	PMID:24640571	PMID:24640572	PMID:24640573	PMID:24681162	PMID:24952961	PMID:26147879
PMID:27626380	PMID:28100033

Genomics

Comparative Map Data

Rln3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	84,769,696 - 84,771,608 (-)	NCBI	GRCm39		mm39
GRCm38	8	84,043,067 - 84,044,979 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,042,929 - 84,045,000 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	86,566,966 - 86,568,878 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	86,933,172 - 86,935,084 (-)	NCBI			mm8
Celera	8	88,337,588 - 88,339,500 (-)	NCBI		Celera
Cytogenetic Map	8	C2	NCBI

RLN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	19	14,028,148 - 14,031,551 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	19	14,028,148 - 14,031,551 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	19	14,139,017 - 14,141,783 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	14,000,017 - 14,002,783 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	19	14,000,016 - 14,002,783	NCBI
Celera	19	14,032,810 - 14,035,579 (+)	NCBI
Cytogenetic Map	19	p13.12	NCBI
HuRef	19	13,711,000 - 13,713,769 (+)	NCBI		HuRef
CHM1_1	19	14,139,507 - 14,142,914 (+)	NCBI		CHM1_1

Rln3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	19	25,164,497 - 25,166,528 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,164,497 - 25,166,528 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,141,375 - 36,143,406 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	25,792,783 - 25,794,814 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	19	25,797,608 - 25,800,095 (+)	NCBI
Celera	19	23,655,324 - 23,657,355 (+)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

Rln3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	32,747,362 - 32,749,338 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	32,747,362 - 32,749,338 (+)	NCBI	ChiLan1.0	ChiLan1.0

RLN3
(Canis lupus familiaris - dog)

No map positions available.

Rln3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936659	2,703,024 - 2,704,664 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RLN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	65,149,890 - 65,162,197 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	65,149,883 - 65,173,306 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	65,424,035 - 65,447,470 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RLN3
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	12,645,677 - 12,679,190 (+)	NCBI
ChlSab1.1 Ensembl	6	12,675,383 - 12,678,601 (+)	Ensembl

Rln3
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624901	1,272,414 - 1,274,670 (+)	NCBI

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32016544	117238700	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	34642776	114837007	Mouse
1301013	Capsq4_m	capsaicin sensitivity related QTL 4 (mouse)			Not determined		8	36163000	92728652	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37400000	109600000	Mouse
12904744	Carcdq1_m	cardiac collagen deposition QTL 1 (mouse)					8	39709256	94689598	Mouse
14746987	Manh64_m	mandible shape 64 (mouse)					8	50053306	84053306	Mouse
14747005	Mancz7_m	mandible centroid size 7 (mouse)					8	50053306	84053306	Mouse
14700686	Civq3_m	cerebral infarct volume QTL 3 (mouse)					8	51882191	85882191	Mouse
1301506	Aevm1_m	autoimmune extremity vasculitis in MRL mice 1 (mouse)			Not determined		8	54287817	88287993	Mouse
1301952	Im3_m	immunoregulatory 3 (mouse)			Not determined		8	54706614	88706763	Mouse
10412287	Carg3_m	Candida albicans resistance gene 3 (mouse)			Not determined		8	55545028	89545028	Mouse
11353828	Gf7_m	gonadal fat pad weight 7 (mouse)					8	58201479	92201479	Mouse
10043975	Obq31_m	obesity QTL 31 (mouse)			Not determined		8	58409776	92409776	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	60786850	94786976	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			63460107	97460107	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	63939547	97939696	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	65357768	99357920	Mouse
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	65600207	99600347	Mouse
1301767	Fcsa2_m	femoral cross-sectional area 2 (mouse)			Not determined		8	70305375	104305495	Mouse
4142283	Imraq2_m	immune response to AAV2 QTL 2 (mouse)			Not determined		8	70305375	104305495	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71102903	105103009	Mouse
4141395	Char2a_m	P. chabaudi malaria resistance QTL 2a (mouse)			Not determined			71136783	90202598	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71287817	123895615	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71287817	123895615	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	71396181	105396393	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73202495	107202598	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	73400000	126100000	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	75675517	109675623	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	75685348	109685497	Mouse
1301808	Nhdlq1_m	non-HDL QTL 1 (mouse)			Not determined		8	75685348	109685497	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	75685348	109685497	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	75685348	109685497	Mouse
1301099	Cbm2_m	cerebellum weight 2 (mouse)			Not determined		8	78518613	112518703	Mouse
1301581	Char2_m	P. chabaudi malaria resistance QTL 2 (mouse)			Not determined		8	79082178	113082403	Mouse
12904012	Cfq10_m	conditioned fear QTL 10 (mouse)					8	80066775	89014359	Mouse
10755530	Wbc2_m	white blood cell count 2 (mouse)					8	81092664	115092664	Mouse
10755519	Wbc1_m	white blood cell count 1 (mouse)					8	81619151	115619151	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	175
Count of miRNA genes:	160
Interacting mature miRNAs:	173
Transcripts:	ENSMUST00000061923
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_173184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB076565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC156028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000061923 ⟹ ENSMUSP00000051392

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	8	84,042,929 - 84,045,000 (-)	Ensembl

RefSeq Acc Id:

NM_173184 ⟹ NP_775276

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	84,769,696 - 84,771,608 (-)	NCBI
GRCm38	8	84,043,067 - 84,044,979 (-)	ENTREZGENE
MGSCv37	8	86,566,966 - 86,568,878 (-)	RGD
Celera	8	88,337,588 - 88,339,500 (-)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

GGTCGCAGGCATCTCAGCTGATCATGGCAATGCTCGGGCTGCTGCTGCTGGCTTCCTGGGCTCT
CCTCGGGGCTCTGGGGCTGCAGGCCGAGGCGAGGCCGGCGCCCTACGGGGTGAAGCTCTGCGGT
CGGGAGTTCATCCGCGCGGTCATCTTCACTTGCGGAGGCTCACGATGGCGCCGGGCGGACATCT
TGGCCCACGAATCTCTGGGGGACTTCTTCGCTGATGGAGAAGCCAATACAGACCACCTGGCCAG
CGAGCTGGATGAAGCGGTGGGCTCCAGCGAGTGGCTGGCCCTAACCAAATCCCCCCAGGCTTTC
TACGGTGGTCGAGCCAGCTGGCAAGGGTCACCTGGAGTGGTTCGGGGCAGCAGAGATGTGTTGG
CTGGCCTTTCCAGCAGTTGCTGCGAGTGGGGCTGTAGCAAGAGCCAAATTAGCAGCTTGTGCTA
GGATCAGGGTTGAGCAATGGAGAAGCG

hide sequence

Protein Sequences


Protein RefSeqs	NP_775276	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC53760	(Get FASTA)	NCBI Sequence Viewer
	EDL10929	(Get FASTA)	NCBI Sequence Viewer
	Q8CHK2	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_775276 ⟸ NM_173184
- Peptide Label:	precursor
- UniProtKB:	Q8CHK2 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAMLGLLLLASWALLGALGLQAEARPAPYGVKLCGREFIRAVIFTCGGSRWRRADILAHESLGD FFADGEANTDHLASELDEAVGSSEWLALTKSPQAFYGGRASWQGSPGVVRGSRDVLAGLSSSCC EWGCSKSQISSLC hide sequence

RefSeq Acc Id:

ENSMUSP00000051392 ⟸ ENSMUST00000061923

Promoters

RGD ID:

8667639

Promoter ID:

EPDNEW_M11851

Type:

multiple initiation site

Name:

Rln3_1

Description:

Mus musculus relaxin 3 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	84,044,989 - 84,045,049	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:2158015	AgrOrtholog
Ensembl Genes	ENSMUSG00000045232	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000051392	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000061923	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	Insulin-like	UniProtKB/Swiss-Prot
	Insulin-like_sf	UniProtKB/Swiss-Prot
	Insulin_CS	UniProtKB/Swiss-Prot
	Insulin_family	UniProtKB/Swiss-Prot
KEGG Report	mmu:212108	UniProtKB/Swiss-Prot
MGD	MGI:2158015	ENTREZGENE
NCBI Gene	212108	ENTREZGENE
Pfam	Insulin	UniProtKB/Swiss-Prot
PhenoGen	Rln3	PhenoGen
PRINTS	INSULINFAMLY	UniProtKB/Swiss-Prot
PROSITE	INSULIN	UniProtKB/Swiss-Prot
SMART	IlGF	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56994	UniProtKB/Swiss-Prot
UniGene	Mm.261583	ENTREZGENE
UniProt	Q8CHK2	ENTREZGENE, UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD