Advanced Search (OLGA)

Gene: Ccl22 (C-C motif chemokine ligand 22) Mus musculus

Analyze

Symbol:

Ccl22

Name:

C-C motif chemokine ligand 22

RGD ID:

1551080

MGI Page

MGI

Description:

Predicted to enable CCR chemokine receptor binding activity and chemokine activity. Predicted to be involved in several processes, including antimicrobial humoral immune response mediated by antimicrobial peptide; chemokine-mediated signaling pathway; and eosinophil chemotaxis. Located in extracellular space. Is expressed in dermis; epidermis; inguinal lymph node; thymus; and thymus primordium. Orthologous to human CCL22 (C-C motif chemokine ligand 22).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ABCD-; ABCD-1; activated B and dendritic cell-derived; C-C motif chemokine 22; CC chemokine ABCD-1; chemokine (C-C motif) ligand 22; DCBCK; dendritic cell and B cell derived chemokine; MDC; Scya; Scya22; SMALL INDUCIBLE CYTOKINE A22 PRECURSOR (CC CHEMOKINE ABCD-1) (ACTIVATED B AND DENDRITIC CELL-DERIVED); small inducible cytokine subfamily A, member 22; small inducible cytokine subfamily A22; small-inducible cytokine A22

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCL22 (C-C motif chemokine ligand 22)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Ccl22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccl22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCL22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCL22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccl22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCL22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103233057 (C-C motif chemokine 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccl22 (C-C motif chemokine ligand 22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Ccl22 (C-C motif chemokine ligand 22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CCL22 (C-C motif chemokine ligand 22)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	95,472,312 - 95,478,016 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	95,472,218 - 95,478,327 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	94,745,684 - 94,751,388 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	94,745,590 - 94,751,699 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	97,269,584 - 97,275,288 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	97,634,719 - 97,640,828 (+)	NCBI		MGSCv36	mm8
Celera	8	99,073,978 - 99,079,588 (+)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	46.75	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

anti-basement membrane glomerulonephritis (ISO)

asthma (IEP,IMP,ISO)

atopic dermatitis (ISO)

Bardet-Biedl syndrome (ISO)

bronchiolitis obliterans (ISO)

cervical squamous cell carcinoma (ISO)

Chromosome 16q12 Duplication Syndrome (ISO)

chronic obstructive pulmonary disease (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

endometriosis (ISO)

lung cancer (ISO)

lymphoproliferative syndrome (ISO)

osteoarthritis (ISO)

Pain (ISO)

pleural tuberculosis (ISO)

pneumonia (ISO)

pulmonary fibrosis (ISO)

Radiation Pneumonitis (ISO)

Respiratory Tract Granuloma (IEP,IMP)

rheumatoid arthritis (ISO)

rhinitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-chloro-2,4-dinitrobenzene (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-phenylprop-2-enal (EXP)

4-hydroxynon-2-enal (EXP)

6-propyl-2-thiouracil (ISO)

acetohydrazide (EXP)

aldehydo-D-glucosamine (ISO)

all-trans-retinoic acid (ISO)

allopurinol (ISO)

alloxanthine (ISO)

alpha-Zearalanol (ISO)

ammonium chloride (ISO)

aripiprazole (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

Bandrowski's base (ISO)

barium sulfate (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

buta-1,3-diene (EXP)

C60 fullerene (ISO)

cannabidiol (EXP,ISO)

capsaicin (ISO)

carbon nanotube (EXP,ISO)

ceric oxide (ISO)

crocidolite asbestos (EXP)

Cuprizon (ISO)

decabromodiphenyl ether (EXP,ISO)

deoxynivalenol (EXP)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (EXP)

dichromium trioxide (ISO)

diisononyl phthalate (EXP)

dimethylarsinic acid (EXP)

dopamine (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

ferric oxide (ISO)

Fexofenadine hydrochloride (ISO)

flavonoids (ISO)

formaldehyde (ISO)

fragrance (ISO)

gentamycin (ISO)

graphite (ISO)

hydralazine (ISO)

inulin (EXP)

lipopolysaccharide (EXP,ISO)

methyl methanesulfonate (ISO)

methylarsonic acid (EXP)

mycophenolic acid (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N,N-diethyl-m-toluamide (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodimethylamine (ISO)

naproxen (ISO)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nickel sulfate (EXP,ISO)

nifuroxazide (ISO)

ozone (EXP,ISO)

perfluorooctane-1-sulfonic acid (EXP)

perfluorooctanoic acid (ISO)

permethrin (ISO)

pevonedistat (ISO)

prostaglandin E2 (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (EXP)

sodium arsenate (EXP)

sodium arsenite (EXP,ISO)

sodium fluoride (EXP)

sotorasib (ISO)

sterigmatocystin (EXP)

succimer (EXP)

sumatriptan (ISO)

thioacetamide (ISO)

titanium dioxide (EXP,ISO)

TMC-120A (EXP)

toluene 2,4-diisocyanate (EXP)

trametinib (ISO)

triptonide (EXP)

trovafloxacin (EXP)

valproic acid (ISO)

vincristine (ISO)

zearalenone (ISO)

zinc oxide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA,ISO)

cell chemotaxis (IEA)

chemokine-mediated signaling pathway (IBA)

eosinophil chemotaxis (IBA)

immune response (IEA)

inflammatory response (IBA,IEA)

killing of cells of another organism (ISO)

positive regulation of cell migration (IBA)

signal transduction (IEA)

Cellular Component

extracellular space (IBA,IDA)

Molecular Function

CCR chemokine receptor binding (IBA)

chemokine activity (IBA,IEA)

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal dendritic cell physiology (IAGP)

preweaning lethality, incomplete penetrance (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Decreased percentage of CD4+FoxP3+ cells in bronchoalveolar lavage from lung transplant recipients correlates with development of bronchiolitis obliterans syndrome.	Bhorade SM, etal., Transplantation. 2010 Sep 15;90(5):540-6.
2.	Cytokine-chemokine networks in experimental mycobacterial and schistosomal pulmonary granuloma formation.	Chiu BC, etal., Am J Respir Cell Mol Biol. 2003 Jul;29(1):106-16. Epub 2003 Jan 10.
3.	Expression of MDC/CCL22 and its receptor CCR4 in rheumatoid arthritis, psoriatic arthritis and osteoarthritis.	Flytlie HA, etal., Cytokine. 2010 Jan;49(1):24-9. doi: 10.1016/j.cyto.2009.10.005. Epub 2009 Nov 25.
4.	Mononuclear cell-infiltrate inhibition by blocking macrophage-derived chemokine results in attenuation of developing crescentic glomerulonephritis.	Garcia GE, etal., Am J Pathol. 2003 Apr;162(4):1061-73.
5.	Mouse monocyte-derived chemokine is involved in airway hyperreactivity and lung inflammation.	Gonzalo JA, etal., J Immunol. 1999 Jul 1;163(1):403-11.
6.	CCL22 and CCL17 in rat radiation pneumonitis and in human idiopathic pulmonary fibrosis.	Inoue T, etal., Eur Respir J. 2004 Jul;24(1):49-56.
7.	Allergic pulmonary inflammation in mice is dependent on eosinophil-induced recruitment of effector T cells.	Jacobsen EA, etal., J Exp Med. 2008 Mar 17;205(3):699-710. Epub 2008 Mar 3.
8.	Role of CCR4 ligands, CCL17 and CCL22, during Schistosoma mansoni egg-induced pulmonary granuloma formation in mice.	Jakubzick C, etal., Am J Pathol. 2004 Oct;165(4):1211-21.
9.	MGDs mouse GO annotations	MGD data from the GO Consortium
10.	Expression of macrophage-derived chemokine (MDC)/CCL22 in human lung cancer.	Nakanishi T, etal., Cancer Immunol Immunother. 2006 Nov;55(11):1320-9. Epub 2006 Feb 2.
11.	Chemokines and glycoprotein120 produce pain hypersensitivity by directly exciting primary nociceptive neurons.	Oh SB, etal., J Neurosci. 2001 Jul 15;21(14):5027-35.
12.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
13.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Elevated expression of TARC (CCL17) and MDC (CCL22) in models of cigarette smoke-induced pulmonary inflammation.	Ritter M, etal., Biochem Biophys Res Commun. 2005 Aug 19;334(1):254-62.
16.	Immunoreactivity profile of peripheral blood mononuclear cells from patients with ragweed-induced allergic rhinitis.	Sun J, etal., Clin Exp Allergy. 2007 Jun;37(6):901-8.
17.	CCL22 is involved in the recruitment of CD4+CD25 high T cells into tuberculous pleural effusions.	Wu C, etal., Respirology. 2010 Apr;15(3):522-9. Epub 2010 Mar 19.
18.	Expression and cellular provenance of thymic stromal lymphopoietin and chemokines in patients with severe asthma and chronic obstructive pulmonary disease.	Ying S, etal., J Immunol. 2008 Aug 15;181(4):2790-8.
19.	Macrophage derived chemokine (CCL22), thymus and activation-regulated chemokine (CCL17), and CCR4 in idiopathic pulmonary fibrosis.	Yogo Y, etal., Respir Res. 2009 Aug 29;10:80.
20.	Negative immune factors might predominate local tumor immune status and promote carcinogenesis in cervical carcinoma.	Zhao M, etal., Virol J. 2017 Jan 13;14(1):5. doi: 10.1186/s12985-016-0670-8.

Additional References at PubMed

PMID:9687523	PMID:10349636	PMID:10382755	PMID:10477717	PMID:10594742	PMID:11042159	PMID:11076861	PMID:11093154	PMID:11217851	PMID:12080938	PMID:12477932	PMID:12629149
PMID:15489334	PMID:15731072	PMID:15843561	PMID:16141072	PMID:16141073	PMID:16602821	PMID:16821125	PMID:18052724	PMID:18184698	PMID:18832724	PMID:19234170	PMID:19414552
PMID:19843945	PMID:19923453	PMID:20940325	PMID:21177120	PMID:21677750	PMID:21737880	PMID:21873635	PMID:22968996	PMID:23460747	PMID:24167272	PMID:25136780	PMID:25200152
PMID:25245466	PMID:25264308	PMID:25271254	PMID:25634358	PMID:25740943	PMID:26683175	PMID:26868141	PMID:27022143	PMID:27195186	PMID:27626662	PMID:27653694	PMID:28466432
PMID:28668835	PMID:30910796	PMID:30973865	PMID:32101016	PMID:32907996	PMID:33597749	PMID:34781732	PMID:35513723	PMID:37353188	PMID:38355793	PMID:38924414

Genomics

Comparative Map Data

Ccl22
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	95,472,312 - 95,478,016 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	95,472,218 - 95,478,327 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	94,745,684 - 94,751,388 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	94,745,590 - 94,751,699 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	97,269,584 - 97,275,288 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	97,634,719 - 97,640,828 (+)	NCBI		MGSCv36	mm8
Celera	8	99,073,978 - 99,079,588 (+)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	46.75	NCBI

CCL22
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	57,357,909 - 57,366,189 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	57,358,783 - 57,366,189 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	57,392,695 - 57,400,101 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	55,950,219 - 55,957,602 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	55,950,218 - 55,957,602	NCBI
Celera	16	41,892,697 - 41,900,098 (+)	NCBI		Celera
Cytogenetic Map	16	q21	NCBI
HuRef	16	43,260,573 - 43,267,982 (+)	NCBI		HuRef
CHM1_1	16	58,800,929 - 58,808,348 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	63,153,028 - 63,161,306 (+)	NCBI		T2T-CHM13v2.0

Ccl22
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,263,589 - 10,270,359 (-)	NCBI		GRCr8
mRatBN7.2	19	10,257,602 - 10,264,373 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,257,601 - 10,264,400 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,220,769 - 10,227,547 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	10,987,615 - 10,994,405 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,274,563 - 10,281,354 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,674,189 - 10,681,145 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,674,189 - 10,681,145 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,668,403 - 10,675,173 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,697,324 - 10,704,129 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,703,571 - 10,708,932 (-)	NCBI
Celera	19	10,143,508 - 10,150,151 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

Ccl22
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	15,001,930 - 15,008,032 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	15,002,001 - 15,007,324 (+)	NCBI	ChiLan1.0	ChiLan1.0

CCL22
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	66,826,127 - 66,834,428 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	72,746,907 - 72,755,202 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	37,631,861 - 37,640,208 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	56,765,370 - 56,770,650 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	56,765,367 - 56,771,213 (+)	Ensembl	panpan1.1		panPan2

CCL22
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	59,039,650 - 59,045,519 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	59,040,539 - 59,045,625 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	55,669,094 - 55,674,886 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	59,577,991 - 59,583,780 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	59,579,632 - 59,583,743 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	56,409,552 - 56,415,344 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	57,417,248 - 57,423,037 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	58,310,530 - 58,316,323 (-)	NCBI		UU_Cfam_GSD_1.0

Ccl22
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	50,151,805 - 50,156,642 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	9,432,505 - 9,436,240 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	9,432,505 - 9,436,240 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCL22
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	19,296,637 - 19,302,737 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	19,296,726 - 19,301,506 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	17,265,026 - 17,294,055 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103233057
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	43,297,206 - 43,305,662 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	43,297,897 - 43,305,642 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	32,922,605 - 32,927,750 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccl22
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	28,694,735 - 28,700,827 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	28,694,879 - 28,700,711 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ccl22
128 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	829
Count of miRNA genes:	509
Interacting mature miRNAs:	583
Transcripts:	ENSMUST00000034231, ENSMUST00000156137
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10043992	Hbnr11_m	Heligmosomoides bakeri nematode resistance 11 (mouse)			Not determined		8	66326836	100326976	Mouse
14696809	Rbcn3_m	rod bipolar cell number 3 (mouse)					8	95056628	102856632	Mouse
1357470	Obq16_m	obesity QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1558875	Eae31_m	experimental allergic encephalomyelitis susceptibility 31 (mouse)			Not determined		8	35109930	115563747	Mouse
1357787	Vtbt5_m	vertebral trabecular bone trait 5 (mouse)			Not determined		8	66084397	100084549	Mouse
1301767	Fcsa2_m	femoral cross-sectional area 2 (mouse)			Not determined		8	71032003	105032123	Mouse
10412234	Nhdlq14_m	non-HDL QTL 14 (mouse)			Not determined		8	76411976	110412125	Mouse
1301766	Desp1_m	despair 1 (mouse)			Not determined		8	85486208	119486373	Mouse
1301253	Skmw2_m	skeletal muscle weight 2 (mouse)			Not determined		8	86443553	120443701	Mouse
4140967	Bmd39_m	bone mineral density 39 (mouse)			Not determined		8	32506572	117965439	Mouse
1357708	Orq1_m	ovulation rate QTL 1 (mouse)			Not determined		8	71740461	124622354	Mouse
4141285	Tgq18_m	triglyceride QTL 18 (mouse)			Not determined			64186736	98186736	Mouse
4141797	Skmw16_m	skeletal muscle weight 16 (mouse)			Not determined		8	64666176	98666325	Mouse
10755519	Wbc1_m	white blood cell count 1 (mouse)					8	82345783	116345783	Mouse
27226754	Femd6_m	femur midshaft diameter 6, 10 week (mouse)					8	37867154	110326632	Mouse
1301581	Char2_m	P. chabaudi malaria resistance QTL 2 (mouse)			Not determined		8	79808806	113809031	Mouse
1301874	Hdlq16_m	HDL QTL 16 (mouse)			Not determined		8	76411976	110412125	Mouse
1301872	Cd4ts3_m	CD4 T cell subset 3 (mouse)			Not determined		8	72122809	106123021	Mouse
10045619	Heal14_m	wound healing/regeneration 14 (mouse)			Not determined		8	86443553	120443701	Mouse
1301688	Orch6_m	autoimmune orchitis resistance 6 (mouse)			Not determined		8	61513479	95513605	Mouse
1558780	Idd22_m	insulin dependent diabetes susceptibility 22 (mouse)			Not determined		8	71829531	105829637	Mouse
1300920	Pitm3_m	prion incubation time 3 (mouse)			Not determined		8	73929123	107929226	Mouse
10755530	Wbc2_m	white blood cell count 2 (mouse)					8	81819296	115819296	Mouse
1302049	Heal1_m	wound healing/regeneration 1 (mouse)			Not determined		8	86443553	120443701	Mouse
27226796	Scvln16_m	sacral vertebrae length 2, 16 week (mouse)					8	89726628	130027694	Mouse
4142283	Imraq2_m	immune response to AAV2 QTL 2 (mouse)			Not determined		8	71032003	105032123	Mouse
27095912	Pglq14_m	pelvic girdle length QTL 14, 16 week (mouse)					8	74126628	126826739	Mouse
4142023	W3q5_m	weight 3 weeks QTL 5 (mouse)			Not determined			71740461	124622354	Mouse
1301099	Cbm2_m	cerebellum weight 2 (mouse)			Not determined		8	79245241	113245331	Mouse
1558890	Lith18_m	lithogenic gene 18 (mouse)			Not determined		8	76402145	110402251	Mouse

Markers in Region

AI449147

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	8	94,751,129 - 94,751,214	UniSTS	GRCm38
MGSCv37	8	97,275,029 - 97,275,114	UniSTS	GRCm37
Celera	8	99,079,329 - 99,079,414	UniSTS
Cytogenetic Map	8	C5	UniSTS
Whitehead/MRC_RH	8	1151.8	UniSTS

Ccl22

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	8	C5	UniSTS
cM Map	8		UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF052505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF076596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF163476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ238238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ315897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK155083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK155764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK156627	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK170080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC012658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BF661256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY198556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000034231 ⟹ ENSMUSP00000034231

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	95,472,218 - 95,478,327 (+)	Ensembl
GRCm38.p6 Ensembl	8	94,745,590 - 94,751,699 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000156137

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	8	95,472,308 - 95,476,501 (+)	Ensembl
GRCm38.p6 Ensembl	8	94,745,680 - 94,749,873 (+)	Ensembl

RefSeq Acc Id:

NM_009137 ⟹ NP_033163

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	8	95,472,312 - 95,478,016 (+)	NCBI
GRCm38	8	94,745,684 - 94,751,388 (+)	ENTREZGENE
MGSCv37	8	97,269,584 - 97,275,288 (+)	RGD
Celera	8	99,073,978 - 99,079,588 (+)	RGD
cM Map	8		ENTREZGENE

Sequence:

show sequence

ATTAGACACCTGACGAGGACACATAACATCATGGCTACCCTGCGTGTCCCACTCCTGGTGGCTC
TCGTCCTTCTTGCTGTGGCAATTCAGACCTCTGATGCAGGTCCCTATGGTGCCAATGTGGAAGA
CAGTATCTGCTGCCAGGACTACATCCGTCACCCTCTGCCATCACGTTTAGTGAAGGAGTTCTTC
TGGACCTCAAAATCCTGCCGCAAGCCTGGCGTTGTTTTGATAACCGTCAAGAACCGAGATATCT
GTGCCGATCCCAGGCAGGTCTGGGTGAAGAAGCTACTCCATAAACTGTCCTAGGGAGGAGGACC
TGATGACCATGGGTCTGGTGTGGTCCAGGGAGGCTCAGCAAGCCCTATTCTTCTGCCATTCCAG
CAAGAGCCTTGCCAACGACGCCACCTTTACTCACCTCCATCCCCTGGGCTGTCACTCTGTGAGG
CTCTGGTCCCTCTACCTCCCCTCTATCCCTTCCAGCTTATCCCCCTTCAATGTGGCAGCTGGGA
AACACATTCAGGCCAGCCTTACCCAATGCCTACTCCCCACTGCTTTAGATGAGACCAGCGTCCT
TGTTTTGATGCCCTGATCCTATGATGCCTTCCCCATCCCCAGCCTTGGCCCCCTTCTCTTCTTG
CATGTAGGGAAGGCCCATAGGTTTCAAATATGTGCTACCTAGTTCCCTTTCTGGGGGGTTCTAA
TACCCAGCATGTTTTTCCTGCTGCAGGCACCTATCCAGTGCCACACACCTCCCAAGTTTCTATC
AGTCCCAGTGGGCATCCACCAAGCCCCAAACTTCAGACTTCCTTGGCCTCCACCTACTCTCAGT
AGAATTCTGGGAGTTTCAGGCTGGTCCACCAGGCCCCCCAGGGTTAGGCCAAGGTCCCCACCAG
AGCTCCTCCTGTTTCTTGGTCTGCAGCACGGGGCAGGGAGCAAGGAGCAGGCTCAGAATCAGAT
TTCTTAAAGGAGCTGCAGACTCCATCAGTAAAAGGAATCTTTCTCCCATCCCTGAATATAAGGC
AGTTTTCTGTCAACACAGAGACTCAGGTTGTTAGAAATGGCCACATAGATCAACTGTGAAACCC
TAAATTTACCAAGAATCAACTTCCACCCCTCTTCAACCACATGCTAGGGTCTTTTACTTTCTCT
GCCCCACACCTTTGACTCCTTGCCTGTGTAGCTGATAGTCGAAGTTATGCTATGGTGTCAGTGA
CTGCCACAGTTTGTTTGGTATTATAAGCTATAGTTATATTTATATAGGAAAGAGGATAAATATA
TGTGAGGCCAAATAGACGAACTGGAGAGTTTTAGGATCTGGGGGCAGGAAGGGCCATACAAAGT
GATACCTCAGAAAATAGATGGTTGTGGGAGCTGCTGCCAGTGGCAGAGTTAACTTAAAGAACTT
AATTGAAATTATTCTTGAGTGGCTGAGGCCAAGACAAGAATATAGAACCCATTCTTGCTTCCCT
GGAGACAACAGTGGTCCCAGGGGAAGGAATAAACCTTCTTGCTCCTCTGGAGGGAGCATGGCCT
GGCTTAGCCGAGTGACTGGACTGTGTGAGATTGGGGGCATCGCTTTTCCTCTCTGAGCCTCAGC
TGACAGCATATGGGACCACAAAGGGCTTGATCCAAACCACAGGGATTGACAGTGCCAGCCACAG
CTGTGTCCAGGGCTCGTGTTCTGCCAGAAGGAGCACCTGGACGACCAGGGCCACCACTAGTGCT
ACTTTGCTCACTGCCCATGCATGTCCTGAAGGTCCCTCCCCCTCCTCTCCTACTTCTGGGAAAA
TAAATGCTCGCCAATAATAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_033163	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC40200	(Get FASTA)	NCBI Sequence Viewer
	AAD50547	(Get FASTA)	NCBI Sequence Viewer
	AAD55763	(Get FASTA)	NCBI Sequence Viewer
	AAH12658	(Get FASTA)	NCBI Sequence Viewer
	BAE33035	(Get FASTA)	NCBI Sequence Viewer
	BAE33426	(Get FASTA)	NCBI Sequence Viewer
	BAE33782	(Get FASTA)	NCBI Sequence Viewer
	BAE41551	(Get FASTA)	NCBI Sequence Viewer
	CAB40894	(Get FASTA)	NCBI Sequence Viewer
	CAC86953	(Get FASTA)	NCBI Sequence Viewer
	EDL11143	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000034231
	ENSMUSP00000034231.4
GenBank Protein	O88430	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_033163 ⟸ NM_009137
- Peptide Label:	precursor
- UniProtKB:	O88430 (UniProtKB/Swiss-Prot), Q546S6 (UniProtKB/TrEMBL), Q9QZU2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MATLRVPLLVALVLLAVAIQTSDAGPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPG VVLITVKNRDICADPRQVWVKKLLHKLS hide sequence

Ensembl Acc Id:

ENSMUSP00000034231 ⟸ ENSMUST00000034231

Protein Domains

Chemokine interleukin-8-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88430-F1-model_v2	AlphaFold	O88430	1-92	view protein structure

Promoters

RGD ID:

8667913

Promoter ID:

EPDNEW_M11988

Type:

multiple initiation site

Name:

Ccl22_1

Description:

Mus musculus chemokine (C-C motif) ligand 22 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	8	94,745,684 - 94,745,744	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1306779	AgrOrtholog
Ensembl Genes	ENSMUSG00000031779	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000034231	ENTREZGENE
	ENSMUST00000034231.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.50.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Chemokine_b/g/d	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chemokine_CC_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chemokine_IL8-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Interleukin_8-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:20299	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1306779	ENTREZGENE
NCBI Gene	20299	ENTREZGENE
PANTHER	PTHR12015	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12015:SF102	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	IL8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ccl22	PhenoGen
PRINTS	INTERLEUKIN8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	SMALL_CYTOKINES_CC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SCY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54117	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	CCL22_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q546S6	ENTREZGENE, UniProtKB/TrEMBL
	Q9QZU2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-07-04	Ccl22	C-C motif chemokine ligand 22	Ccl22	chemokine (C-C motif) ligand 22	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype