ADIPOQ (adiponectin, C1Q and collagen domain containing)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: ADIPOQ (adiponectin, C1Q and collagen domain containing) Sus scrofa

Analyze

Symbol:

ADIPOQ

Name:

adiponectin, C1Q and collagen domain containing

RGD ID:

14153993

Description:

ENCODES a protein that exhibits hormone activity (ortholog); identical protein binding (ortholog); signaling receptor binding (ortholog); INVOLVED IN brown fat cell differentiation (ortholog); cellular response to cAMP (ortholog); cellular response to epinephrine stimulus (ortholog); PARTICIPATES IN adiponectin signaling pathway; ASSOCIATED WITH 3MC syndrome 1 (ortholog); Acute Lung Injury (ortholog); Alcoholic Fatty Liver (ortholog); FOUND IN cell periphery (ortholog); cell surface (ortholog); endoplasmic reticulum (ortholog); INTERACTS WITH 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether; benzo[a]pyrene

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ACDC; ACRP30; adiponectin; ADN; APM1

RGD Orthologs

Human

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

Sscrofa11.1 - Pig Sscrofa11.1 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	124,633,685 - 124,646,646 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	124,633,906 - 124,646,237 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	134,076,753 - 134,077,342 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3MC syndrome 1 (ISO)

Acute Lung Injury (ISO)

Alcoholic Fatty Liver (ISO)

Alzheimer's disease (ISO)

amyloidosis (ISO)

ankylosing spondylitis (ISO)

asthma (ISO)

atherosclerosis (ISO)

autoimmune hepatitis (ISO)

Behcet's disease (ISO)

biliary atresia (ISO)

bipolar disorder (ISO)

brain infarction (ISO)

breast cancer (ISO)

cardiomyopathy (ISO)

cardiovascular system disease (ISO)

Chemical and Drug Induced Liver Injury (ISO)

Choroidal Neovascularization (ISO)

Chronic Hepatitis C (ISO)

chronic obstructive pulmonary disease (ISO)

Cognitive Dysfunction (ISO)

colitis (ISO)

congestive heart failure (ISO)

coronary aneurysm (ISO)

coronary artery disease (ISO)

Coronary Disease (ISO)

coronary restenosis (ISO)

Crohn's disease (ISO)

dementia (ISO)

diabetes mellitus (ISO)

Diabetic Cardiomyopathies (ISO)

Diabetic Foot (ISO)

Diabetic Nephropathies (ISO)

diabetic retinopathy (ISO)

diffuse scleroderma (ISO)

dry eye syndrome (ISO)

end stage renal disease (ISO)

Endotoxemia (ISO)

Experimental Arthritis (ISO)

Experimental Autoimmune Myocarditis (ISO)

Experimental Diabetes Mellitus (ISO)

Experimental Liver Cirrhosis (ISO)

familial hyperlipidemia (ISO)

familial Mediterranean fever (ISO)

fatty liver disease (ISO)

Fetal Growth Retardation (ISO)

gestational diabetes (ISO)

Graft vs Host Disease (ISO)

Graves' disease (ISO)

hepatocellular carcinoma (ISO)

heroin dependence (ISO)

HIV-Associated Lipodystrophy Syndrome (ISO)

Human Viral Hepatitis (ISO)

Huntington's disease (ISO)

Hyperemia (ISO)

hyperglycemia (ISO)

hyperinsulinism (ISO)

hypertension (ISO)

hyperthyroidism (ISO)

Hypertriglyceridemia (ISO)

Hypoadiponectinemia (ISO)

Inflammation (ISO)

inflammatory bowel disease (ISO)

Insulin Resistance (ISO)

Jaundice (ISO)

Kawasaki disease (ISO)

Kidney Reperfusion Injury (ISO)

Left Ventricular Hypertrophy (ISO)

liver cirrhosis (ISO)

Liver Reperfusion Injury (ISO)

Mammary Neoplasms, Experimental (ISO)

Masked Hypertension (ISO)

Metabolic Syndrome (ISO)

multiple sclerosis (ISO)

Mycobacterium avium complex disease (ISO)

myocardial infarction (ISO)

Myocardial Ischemia (ISO)

Myocardial Reperfusion Injury (ISO)

myocarditis (ISO)

non-alcoholic fatty liver disease (ISO)

obesity (ISO)

Oxygen-Induced Retinopathy (ISO)

Perennial Allergic Rhinitis (ISO)

peripheral artery disease (ISO)

polycystic ovary syndrome (ISO)

primary open angle glaucoma (ISO)

proliferative diabetic retinopathy (ISO)

prostate adenocarcinoma (ISO)

pulmonary edema (ISO)

pulmonary emphysema (ISO)

pulmonary fibrosis (ISO)

pulmonary hypertension (ISO)

pulmonary tuberculosis (ISO)

renal cell carcinoma (ISO)

Reperfusion Injury (ISO)

Rett syndrome (ISO)

rheumatoid arthritis (ISO)

Sepsis (ISO)

sleep apnea (ISO)

Spinal Cord Injuries (ISO)

Stroke (ISO)

Subarachnoid Hemorrhage (ISO)

systemic lupus erythematosus (ISO)

tongue squamous cell carcinoma (ISO)

type 1 diabetes mellitus (ISO)

type 2 diabetes mellitus (ISO)

ulcerative colitis (ISO)

vascular disease (ISO)

visual epilepsy (ISO)

Weight Gain (ISO)

Weight Loss (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

benzo[a]pyrene (EXP)

bisphenol A (EXP)

hexachlorobenzene (EXP)

testosterone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brown fat cell differentiation (IEA,ISO,ISS)

cellular response to cAMP (ISO)

cellular response to epinephrine stimulus (ISO)

cellular response to insulin stimulus (IEA,ISO,ISS)

cellular response to xenobiotic stimulus (IEA,ISS)

circadian rhythm (ISO)

detection of oxidative stress (IEA,ISS)

fatty acid beta-oxidation (IEA,ISO,ISS)

fatty acid oxidation (IEA,ISO,ISS)

gene expression (IEA,ISO)

glucose homeostasis (IEA,ISO,ISS)

glucose metabolic process (IEA,ISO,ISS)

low-density lipoprotein particle clearance (IEA,ISS)

negative regulation of blood pressure (IEA,ISS)

negative regulation of cell migration (IEA,ISS)

negative regulation of cold-induced thermogenesis (IEA)

negative regulation of DNA biosynthetic process (IEA,ISS)

negative regulation of DNA-templated transcription (IEA,ISS)

negative regulation of ERK1 and ERK2 cascade (IEA,ISS)

negative regulation of fat cell differentiation (IEA,ISS)

negative regulation of gluconeogenesis (IEA,ISO,ISS)

negative regulation of granulocyte differentiation (IEA,ISS)

negative regulation of heterotypic cell-cell adhesion (IEA,ISS)

negative regulation of hormone secretion (ISO)

negative regulation of I-kappaB kinase/NF-kappaB signaling (IEA,ISS)

negative regulation of inflammatory response (IEA,ISS)

negative regulation of intracellular protein transport (IEA,ISS)

negative regulation of low-density lipoprotein receptor activity (IEA,ISO)

negative regulation of macrophage derived foam cell differentiation (IEA,ISS)

negative regulation of macrophage differentiation (IEA,ISS)

negative regulation of MAP kinase activity (IEA,ISS)

negative regulation of metanephric mesenchymal cell migration (IEA,ISS)

negative regulation of phagocytosis (IEA,ISS)

negative regulation of platelet-derived growth factor receptor signaling pathway (IEA,ISS)

negative regulation of platelet-derived growth factor receptor-alpha signaling pathway (IEA,ISS)

negative regulation of protein autophosphorylation (IEA,ISS)

negative regulation of receptor binding (IEA,ISS)

negative regulation of synaptic transmission (IEA,ISS)

negative regulation of tumor necrosis factor production (IEA,ISS)

negative regulation of tumor necrosis factor-mediated signaling pathway (IEA,ISS)

negative regulation of vascular associated smooth muscle cell migration (IEA,ISS)

negative regulation of vascular associated smooth muscle cell proliferation (IEA,ISS)

positive regulation of cAMP-dependent protein kinase activity (IEA,ISS)

positive regulation of cholesterol efflux (IEA,ISS)

positive regulation of cold-induced thermogenesis (IEA)

positive regulation of fatty acid metabolic process (IEA,ISO,ISS)

positive regulation of glucose import (IEA,ISO,ISS)

positive regulation of glycogen (starch) synthase activity (ISS)

positive regulation of I-kappaB kinase/NF-kappaB signaling (IEA,ISO,ISS)

positive regulation of interleukin-8 production (IEA,ISS)

positive regulation of lipid transporter activity (IEA,ISS)

positive regulation of metanephric podocyte development (IEA,ISS)

positive regulation of monocyte chemotactic protein-1 production (IEA,ISS)

positive regulation of myeloid cell apoptotic process (IEA,ISS)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

positive regulation of protein kinase A signaling (IEA,ISS)

positive regulation of protein kinase activity (ISO)

positive regulation of protein phosphorylation (IEA,ISS)

positive regulation of renal albumin absorption (IEA,ISS)

positive regulation of signal transduction (IEA,ISO,ISS)

protein localization to plasma membrane (IEA,ISS)

regulation of glucose metabolic process (IEA,ISS)

response to activity (ISO)

response to bacterium (IEA,ISO)

response to ethanol (ISO)

response to glucocorticoid (ISO)

response to glucose (IEA,ISO,ISS)

response to hypoxia (ISO)

response to linoleic acid (ISO)

response to nutrient (ISO)

response to nutrient levels (ISO)

response to sucrose (ISO)

response to tumor necrosis factor (IEA,ISS)

response to xenobiotic stimulus (ISO)

signal transduction (IEA)

Cellular Component

cell periphery (ISS)

cell surface (IEA,ISS)

endoplasmic reticulum (IEA,ISS)

extracellular region (IEA)

extracellular space (IEA,ISO,ISS)

perinuclear region of cytoplasm (ISS)

protein-containing complex (ISO)

Molecular Function

hormone activity (IEA,ISS)

identical protein binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA)

sialic acid binding (IEA)

signaling receptor binding (IEA,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

adiponectin signaling pathway (ISO)

References

Additional References at PubMed

PMID:15033490	PMID:15225138	PMID:15542462	PMID:16055297	PMID:18054196	PMID:18384464	PMID:18535556	PMID:19217884	PMID:19840923	PMID:20484463	PMID:23164042	PMID:23548631
PMID:23879259	PMID:24592982	PMID:24598213	PMID:25129870	PMID:28063235	PMID:28089263	PMID:28177362	PMID:30851697	PMID:32708964

Genomics

Comparative Map Data

ADIPOQ
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	124,633,685 - 124,646,646 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	124,633,906 - 124,646,237 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	134,076,753 - 134,077,342 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADIPOQ
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	186,842,710 - 186,858,463 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	186,842,704 - 186,858,463 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	186,560,499 - 186,576,252 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	188,043,157 - 188,058,946 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	3	188,043,164 - 188,058,952	NCBI
Celera	3	184,996,682 - 185,012,474 (+)	NCBI
Cytogenetic Map	3	q27.3	NCBI
HuRef	3	183,969,546 - 183,985,186 (+)	NCBI		HuRef
CHM1_1	3	186,523,992 - 186,539,778 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	189,664,780 - 189,680,531 (+)	NCBI

Adipoq
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	22,965,286 - 22,976,718 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	16	22,965,286 - 22,976,778 (+)	Ensembl
GRCm38	16	23,146,536 - 23,157,968 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	23,146,536 - 23,158,028 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	23,146,609 - 23,158,041 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	16	23,061,870 - 23,073,302 (+)	NCBI			mm8
Celera	16	23,704,853 - 23,716,285 (+)	NCBI		Celera
Cytogenetic Map	16	B1	NCBI
cM Map	16	13.96	NCBI

Adipoq
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	77,721,912 - 77,735,644 (-)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	11	77,721,912 - 77,735,564 (-)	Ensembl
Rnor_6.0	11	81,330,845 - 81,344,488 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	81,330,293 - 81,344,488 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	84,363,940 - 84,382,663 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	79,908,291 - 79,911,065 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	11	79,965,888 - 79,968,654 (-)	NCBI
Celera	11	76,596,543 - 76,599,824 (-)	NCBI		Celera
Cytogenetic Map	11	q23	NCBI

Adipoq
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	20,912,348 - 20,914,402 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	20,911,181 - 20,922,992 (-)	NCBI	ChiLan1.0	ChiLan1.0

ADIPOQ
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	192,341,471 - 192,354,885 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	192,341,320 - 192,354,885 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	3	183,876,051 - 183,889,723 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

ADIPOQ
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	19,398,310 - 19,410,519 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	19,354,825 - 19,409,844 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	23,492,088 - 23,493,907 (+)	NCBI
ROS_Cfam_1.0	34	19,309,590 - 19,321,861 (+)	NCBI
ROS_Cfam_1.0 Ensembl	34	19,309,535 - 19,321,387 (+)	Ensembl
UMICH_Zoey_3.1	34	19,349,075 - 19,350,894 (+)	NCBI
UNSW_CanFamBas_1.0	34	19,348,981 - 19,350,799 (+)	NCBI
UU_Cfam_GSD_1.0	34	19,582,218 - 19,584,037 (+)	NCBI

Adipoq
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	117,076,470 - 117,087,548 (-)	NCBI
SpeTri2.0	NW_004936578	3,168,599 - 3,179,369 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADIPOQ
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	81,128,427 - 81,142,779 (+)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	15	81,129,795 - 81,147,391 (+)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666041	54,621,772 - 54,634,568 (+)	NCBI	Vero_WHO_p1.0

Adipoq
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	69,941,001 - 69,957,012 (-)	Ensembl	HetGla_female_1.0		hetGla2
HetGla 1.0	NW_004624730	69,941,963 - 69,959,266 (-)	NCBI	HetGla_female_1.0		hetGla2

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	hemolymphoid system	musculoskeletal system	nervous system	reproductive system	respiratory system
High
Medium		2	2	2
Low	5		1		1		2
Below cutoff	5	2			4	2	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_214370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AEMK02000089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ849536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK349759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY135647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY320353	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY340939	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY347315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY563526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY589691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY627882	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ164207	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ164208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ164209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF446130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF601160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU076587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU423273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU489740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU522924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU522925	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EU522926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FP236586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GFLN01078416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF730719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN634961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JX092267	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSSSCT00000038265 ⟹ ENSSSCP00000043451

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	13	124,633,685 - 124,646,248 (+)	Ensembl

RefSeq Acc Id:

ENSSSCT00000047495 ⟹ ENSSSCP00000045756

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	13	124,633,894 - 124,646,646 (+)	Ensembl

RefSeq Acc Id:

ENSSSCT00000050445 ⟹ ENSSSCP00000046998

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	13	124,641,951 - 124,646,248 (+)	Ensembl

RefSeq Acc Id:

NM_214370 ⟹ NP_999535

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1	13	124,633,906 - 124,646,237 (+)	NCBI

Sequence:

show sequence

GGCCACGCGTNTNCTAATACGGGGGGNTTGGGGGGGGGGGGATCCTGACTGCAGTCTGTGGCTC
TGATTCCACACCTGAGGGGCTCAGGATGCTGTTGTTGGGAGCTGTTCTACTGCTACTAGCCCTG
CCCAGTCTCGGCCAGGAAACCACCGAGAAGCCTGGAGCACTACTGCCCATGCCCAAGGGGGCCT
GCGCAGGCTGGATGGCGGGTATCCCAGGGCATCCTGGCCACAACGGTACCCCAGGCCGTGATGG
CAGAGATGGCGTCCCTGGCGAGAAGGGTGAGAAAGGANATACAGGTCTTACTGNTCCNAAGGGT
GACACTGGGGAATCTGGAGTGACTGGGGTTGAAGGTCCCCGAGGTTTCCCAGGAATCCCGGGCA
GAAAAGGAGAACCTGGAGAAAGCGCCTATGTCTACCGTTCAGCATTCAGTGTGGGCCTGGAGAC
TCGGGTCACTGTCCCTAACATGCCCATTCGCTNTACCAAGATCTTCTACAATCAGCAAAATCAC
TATGATGTCACCACTGGCAAATTCCACTGCAACATTCCTGGGCTGTACTACTTCTCCTTCCACG
TCACGGTCTACTTGAAGGATGTGAAGGTCAGCCTCTACAAGAAGGACAAGGCTGTACTCTTCAC
CTACGACCAGTACCAGGACAAGAATGTGGACCAGGCCTCTGGCTCTGTGCTCCTCTATCTGGAG
AAGGGGGACCAAGTCTGGCTCCAGGCATACGGGGATGAAGAGAATAATGGGGTCTATGCTGACA
ATGTCAATGACTCCATCTTCACAGGCTTCCTTCTCTACCACAACATTGAATGATGAGCACTGCC
AACTCAGAGCCTCCACCAGGCTGAGGTCTTCAGTGTCATTAGGAGACTGATTGGATTATNTAAT
TGGAGGGCTNTGAACATTATTCATTGATTGACTCATTCATACCCAAATATCTTTTTTTTTTTTT
TTTTTTTTGCTTTGGTTTTTTTTTATAGGGCCTCTTGAATCTACTCTTGATCTTTAAGAATTAC
AAAAAAAAAAAAAAAAAGCTTCGAATTCAGGACCAATCACGAATTCTGACCGANCGAACGAGTN
CAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_999535	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAN11297	(Get FASTA)	NCBI Sequence Viewer
	AAQ22996	(Get FASTA)	NCBI Sequence Viewer
	AAQ24844	(Get FASTA)	NCBI Sequence Viewer
	AAQ83880	(Get FASTA)	NCBI Sequence Viewer
	AAS75592	(Get FASTA)	NCBI Sequence Viewer
	AAT00459	(Get FASTA)	NCBI Sequence Viewer
	AAU87581	(Get FASTA)	NCBI Sequence Viewer
	AAZ86516	(Get FASTA)	NCBI Sequence Viewer
	AAZ86517	(Get FASTA)	NCBI Sequence Viewer
	AAZ86518	(Get FASTA)	NCBI Sequence Viewer
	ABO30578	(Get FASTA)	NCBI Sequence Viewer
	ABQ95350	(Get FASTA)	NCBI Sequence Viewer
	ABW74504	(Get FASTA)	NCBI Sequence Viewer
	ABZ85675	(Get FASTA)	NCBI Sequence Viewer
	ACA50588	(Get FASTA)	NCBI Sequence Viewer
	ACB06567	(Get FASTA)	NCBI Sequence Viewer
	ACB06568	(Get FASTA)	NCBI Sequence Viewer
	ACB06569	(Get FASTA)	NCBI Sequence Viewer
	AEO36949	(Get FASTA)	NCBI Sequence Viewer
	AEO53063	(Get FASTA)	NCBI Sequence Viewer
	AFO73183	(Get FASTA)	NCBI Sequence Viewer
	CAH61062	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_999535 ⟸ NM_214370
- Peptide Label:	precursor
- UniProtKB:	Q7YRF8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLLLGAVLLLLALPSLGQETTEKPGALLPMPKGACAGWMAGIPGHPGHNGTPGRDGRDGVPGEK GEKGXTGLTXPKGDTGESGVTGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLETRVTVPNMP IRXTKIFYNQQNHYDVTTGKFHCNIPGLYYFSFHVTVYLKDVKVSLYKKDKAVLFTYDQYQDKN VDQASGSVLLYLEKGDQVWLQAYGDEENNGVYADNVNDSIFTGFLLYHNIE hide sequence

RefSeq Acc Id:

ENSSSCP00000046998 ⟸ ENSSSCT00000050445

RefSeq Acc Id:

ENSSSCP00000043451 ⟸ ENSSSCT00000038265

RefSeq Acc Id:

ENSSSCP00000045756 ⟸ ENSSSCT00000047495

Protein Domains

C1q

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSSSCG00000039103	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSSSCG00015040628	UniProtKB/TrEMBL
	ENSSSCG00025002178	UniProtKB/TrEMBL
	ENSSSCG00030011368	UniProtKB/TrEMBL
	ENSSSCG00035081055	UniProtKB/TrEMBL
	ENSSSCG00045012558	UniProtKB/TrEMBL
	ENSSSCG00050043319	UniProtKB/TrEMBL
	ENSSSCG00055018748	UniProtKB/TrEMBL
	ENSSSCG00065011657	UniProtKB/TrEMBL
	ENSSSCG00070016615	UniProtKB/TrEMBL
Ensembl Protein	ENSSSCP00000043451.1	UniProtKB/TrEMBL
	ENSSSCP00000045756	ENTREZGENE
	ENSSSCP00000045756.1	UniProtKB/TrEMBL
	ENSSSCP00000046998.2	UniProtKB/TrEMBL
	ENSSSCP00015021849.1	UniProtKB/TrEMBL
	ENSSSCP00025000989.1	UniProtKB/TrEMBL
	ENSSSCP00025000996.1	UniProtKB/TrEMBL
	ENSSSCP00025001004.1	UniProtKB/TrEMBL
	ENSSSCP00030007019.1	UniProtKB/TrEMBL
	ENSSSCP00035048753.1	UniProtKB/TrEMBL
	ENSSSCP00035048760.1	UniProtKB/TrEMBL
	ENSSSCP00045014683.1	UniProtKB/TrEMBL
	ENSSSCP00050025286.1	UniProtKB/TrEMBL
	ENSSSCP00050025289.1	UniProtKB/TrEMBL
	ENSSSCP00050025290.1	UniProtKB/TrEMBL
	ENSSSCP00055029176.1	UniProtKB/TrEMBL
	ENSSSCP00065006323.1	UniProtKB/TrEMBL
	ENSSSCP00065006327.1	UniProtKB/TrEMBL
	ENSSSCP00065006334.1	UniProtKB/TrEMBL
	ENSSSCP00070027327.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSSSCT00000038265.2	UniProtKB/TrEMBL
	ENSSSCT00000047495	ENTREZGENE
	ENSSSCT00000047495.2	UniProtKB/TrEMBL
	ENSSSCT00000050445.2	UniProtKB/TrEMBL
	ENSSSCT00015054497.1	UniProtKB/TrEMBL
	ENSSSCT00025002792.1	UniProtKB/TrEMBL
	ENSSSCT00025002806.1	UniProtKB/TrEMBL
	ENSSSCT00025002818.1	UniProtKB/TrEMBL
	ENSSSCT00030015614.1	UniProtKB/TrEMBL
	ENSSSCT00035111334.1	UniProtKB/TrEMBL
	ENSSSCT00035111345.1	UniProtKB/TrEMBL
	ENSSSCT00045021354.1	UniProtKB/TrEMBL
	ENSSSCT00050058941.1	UniProtKB/TrEMBL
	ENSSSCT00050058946.1	UniProtKB/TrEMBL
	ENSSSCT00050058949.1	UniProtKB/TrEMBL
	ENSSSCT00055036708.1	UniProtKB/TrEMBL
	ENSSSCT00065015506.1	UniProtKB/TrEMBL
	ENSSSCT00065015516.1	UniProtKB/TrEMBL
	ENSSSCT00065015527.1	UniProtKB/TrEMBL
	ENSSSCT00070032735.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/TrEMBL
InterPro	Adiponectin	UniProtKB/TrEMBL
	C1q_dom	UniProtKB/TrEMBL
	Collagen	UniProtKB/TrEMBL
	Tumour_necrosis_fac-like_dom	UniProtKB/TrEMBL
KEGG Report	ssc:397660	UniProtKB/TrEMBL
NCBI Gene	ADIPOQ	ENTREZGENE
PANTHER	PTHR15427:SF20	UniProtKB/TrEMBL
Pfam	C1q	UniProtKB/TrEMBL
	Collagen	UniProtKB/TrEMBL
PRINTS	COMPLEMNTC1Q	UniProtKB/TrEMBL
PROSITE	C1Q	UniProtKB/TrEMBL
SMART	C1Q	UniProtKB/TrEMBL
Superfamily-SCOP	SSF49842	UniProtKB/TrEMBL
UniProt	A0A287AHI7_PIG	UniProtKB/TrEMBL
	A0A287ASX3_PIG	UniProtKB/TrEMBL
	A0A4X1UH39_PIG	UniProtKB/TrEMBL
	A0A8D1MJG3_PIG	UniProtKB/TrEMBL
	A0A8D1MND0_PIG	UniProtKB/TrEMBL
	A0A8D1TGC3_PIG	UniProtKB/TrEMBL
	A0A8D1XIM8_PIG	UniProtKB/TrEMBL
	A0A8D1XIV2_PIG	UniProtKB/TrEMBL
	B1PSB6_PIG	UniProtKB/TrEMBL
	I7DBK6_PIG	UniProtKB/TrEMBL
	Q6PP07_PIG	UniProtKB/TrEMBL
	Q7YRF8	ENTREZGENE, UniProtKB/TrEMBL
VGNC ID	VGNC:85140	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations