Stk19 (serine/threonine kinase 19)

Advanced Search (OLGA)

Gene: Stk19 (serine/threonine kinase 19) Rattus norvegicus

Analyze

Symbol:

Stk19 (Ensembl: AABR07044389.1)

Name:

serine/threonine kinase 19

RGD ID:

1359601

Description:

Predicted to be involved in positive regulation of Ras protein signal transduction. Predicted to be located in cytoplasm and nuclear speck. Orthologous to human STK19 (serine/threonine kinase 19); INTERACTS WITH 2,4-dinitrotoluene; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

inactive serine/threonine-protein kinase 19; serine/threonine-protein kinase 19

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Stk19-ps

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	4,000,216 - 4,009,743 (+)	NCBI		GRCr8
mRatBN7.2	20	3,995,590 - 4,005,117 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,995,587 - 4,005,116 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,695,543 - 4,705,058 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,057,291 - 4,066,806 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,594,472 - 4,603,980 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,317,440 - 4,517,128 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	20	6,396,796 - 6,596,927 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,095,981 - 4,105,509 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,096,207 - 4,105,735 (+)	NCBI
Celera	20	4,025,587 - 4,035,112 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

basal cell carcinoma (ISO)

melanoma (ISO)

proteasome-associated autoinflammatory syndrome 1 (ISO)

skin melanoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

3,3',5-triiodo-L-thyronine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

CGP 52608 (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nickel sulfate (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

temozolomide (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of Ras protein signal transduction (ISO)

Cellular Component

cytoplasm (ISO)

nuclear speck (IEA,ISO)

nucleus (ISO)

Molecular Function

protein binding (ISO)

protein serine/threonine kinase activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The G11 gene located in the major histocompatibility complex encodes a novel nuclear serine/threonine protein kinase.	Gomez-Escobar N, etal., J Biol Chem 1998 Nov 20;273(47):30954-60.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
6.	Physical mapping of the major histocompatibility complex class II and class III regions of the rat.	Walter L, etal., Immunogenetics 2002 Jul;54(4):268-75. Epub 2002 Jun 14.

Additional References at PubMed

PMID:30712867

Genomics

Comparative Map Data

Stk19
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	4,000,216 - 4,009,743 (+)	NCBI		GRCr8
mRatBN7.2	20	3,995,590 - 4,005,117 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,995,587 - 4,005,116 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,695,543 - 4,705,058 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	4,057,291 - 4,066,806 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,594,472 - 4,603,980 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	4,317,440 - 4,517,128 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	20	6,396,796 - 6,596,927 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	4,095,981 - 4,105,509 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	4,096,207 - 4,105,735 (+)	NCBI
Celera	20	4,025,587 - 4,035,112 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

STK19
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,971,175 - 31,981,446 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,971,091 - 31,982,821 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,938,952 - 31,949,223 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	32,047,625 - 32,057,202 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	32,047,624 - 32,057,202	NCBI
Celera	6	33,538,714 - 33,548,985 (+)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,725,889 - 31,736,233 (+)	NCBI		HuRef
CHM1_1	6	31,941,033 - 31,951,304 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,824,380 - 31,834,652 (+)	NCBI		T2T-CHM13v2.0

Stk19
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,042,969 - 35,055,879 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,042,969 - 35,055,921 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	34,823,993 - 34,836,903 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	34,823,993 - 34,836,945 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	34,960,938 - 34,973,848 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,432,049 - 34,444,959 (-)	NCBI		MGSCv36	mm8
Celera	17	37,919,308 - 37,932,232 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.38	NCBI

Stk19
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	485,110 - 492,493 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	485,110 - 492,493 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100989926
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,482,054 - 46,483,081 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,443,548 - 42,444,566 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,666,381 - 31,667,410 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,519,250 - 32,526,782 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,519,252 - 32,526,782 (+)	Ensembl	panpan1.1		panPan2

LOC488436
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	27,227,496 - 27,228,457 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	27,125,447 - 27,126,267 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	27,384,792 - 27,385,376 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	36	27,507,298 - 27,507,896 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	27,441,589 - 27,442,173 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	27,591,797 - 27,592,381 (-)	NCBI		UU_Cfam_GSD_1.0

Stk19
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,984,559 - 35,990,696 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,570,678 - 1,577,026 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,570,650 - 1,576,796 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STK19
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	24,059,452 - 24,067,384 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	24,060,226 - 24,067,398 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,744,802 - 27,751,975 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STK19
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,042,264 - 40,049,983 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,009,273 - 40,049,936 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,888,740 - 31,895,348 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Stk19
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	24,271,875 - 24,280,939 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	24,271,284 - 24,280,963 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Stk19
55 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	255
Count of miRNA genes:	170
Interacting mature miRNAs:	189
Transcripts:	ENSRNOT00000000484, ENSRNOT00000072446
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61472	Aia1	Adjuvant induced arthritis QTL 1	18	0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	2646395	4597031	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
61448	Ciaa1	CIA Autoantibody QTL 1	30	0.001	blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	20	2646395	4597031	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
737973	Pia21	Pristane induced arthritis QTL 21	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	4606812	Rat

Markers in Region

D20Got102

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,146,373 - 4,146,535 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,367,694 - 4,367,855	NCBI	Rnor6.0
Rnor_5.0	20	6,447,050 - 6,447,211	UniSTS	Rnor5.0
RGSC_v3.4	20	4,248,837 - 4,248,998	UniSTS	RGSC3.4
Celera	20	3,883,668 - 3,883,842	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Yum62

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,127,533 - 4,127,683 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,386,543 - 4,386,692	NCBI	Rnor6.0
Rnor_5.0	20	6,465,899 - 6,466,048	UniSTS	Rnor5.0
RGSC_v3.4	20	4,229,412 - 4,229,561	UniSTS	RGSC3.4
Celera	20	3,902,577 - 3,902,730	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Yum58

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,998,581 - 3,998,751 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,513,967 - 4,514,136	NCBI	Rnor6.0
Rnor_5.0	20	6,593,766 - 6,593,935	UniSTS	Rnor5.0
RGSC_v3.4	20	4,098,973 - 4,099,142	UniSTS	RGSC3.4
Celera	20	4,031,953 - 4,032,120	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Yum61

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,099,411 - 4,099,577 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,413,628 - 4,413,793	NCBI	Rnor6.0
Rnor_5.0	20	6,492,984 - 6,493,149	UniSTS	Rnor5.0
RGSC_v3.4	20	4,200,675 - 4,200,840	UniSTS	RGSC3.4
Celera	20	3,930,624 - 3,930,789	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Yum63

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,171,433 - 4,171,590 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,342,640 - 4,342,796	NCBI	Rnor6.0
Rnor_5.0	20	6,421,996 - 6,422,152	UniSTS	Rnor5.0
RGSC_v3.4	20	4,274,327 - 4,274,483	UniSTS	RGSC3.4
Celera	20	3,858,677 - 3,858,833	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Yum59

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,031,068 - 4,031,242 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,481,956 - 4,482,129	NCBI	Rnor6.0
Rnor_5.0	20	6,561,312 - 6,561,485	UniSTS	Rnor5.0
RGSC_v3.4	20	4,132,407 - 4,132,580	UniSTS	RGSC3.4
Celera	20	3,998,885 - 3,999,058	UniSTS
Cytogenetic Map	20	p12	UniSTS

D20Yum60

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,057,277 - 4,057,419 (-)	MAPPER	mRatBN7.2
mRatBN7.2	20	4,057,158 - 4,057,419 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,455,780 - 4,456,040	NCBI	Rnor6.0
Rnor_6.0	20	4,455,780 - 4,455,921	NCBI	Rnor6.0
Rnor_5.0	20	6,535,136 - 6,535,277	UniSTS	Rnor5.0
Rnor_5.0	20	6,535,136 - 6,535,396	UniSTS	Rnor5.0
RGSC_v3.4	20	4,158,629 - 4,158,770	UniSTS	RGSC3.4
Celera	20	3,972,709 - 3,972,969	UniSTS
Celera	20	3,972,709 - 3,972,850	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH138792

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,099,916 - 4,100,062 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,413,143 - 4,413,288	NCBI	Rnor6.0
Rnor_5.0	20	6,492,499 - 6,492,644	UniSTS	Rnor5.0
RGSC_v3.4	20	4,201,180 - 4,201,325	UniSTS	RGSC3.4
Celera	20	3,930,139 - 3,930,284	UniSTS
RH 3.4 Map	20	53.23	UniSTS
Cytogenetic Map	20	p12	UniSTS

BF390804

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,136,626 - 4,136,811 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,377,418 - 4,377,602	NCBI	Rnor6.0
Rnor_5.0	20	6,456,774 - 6,456,958	UniSTS	Rnor5.0
RGSC_v3.4	20	4,238,468 - 4,238,652	UniSTS	RGSC3.4
Celera	20	3,893,443 - 3,893,627	UniSTS
RH 3.4 Map	20	53.1	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH131882

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,118,003 - 4,118,153 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,396,075 - 4,396,224	NCBI	Rnor6.0
Rnor_5.0	20	6,475,431 - 6,475,580	UniSTS	Rnor5.0
RGSC_v3.4	20	4,219,884 - 4,220,033	UniSTS	RGSC3.4
Celera	20	3,912,108 - 3,912,257	UniSTS
RH 3.4 Map	20	53.02	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH133069

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,157,191 - 4,157,392 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,356,838 - 4,357,038	NCBI	Rnor6.0
Rnor_5.0	20	6,436,194 - 6,436,394	UniSTS	Rnor5.0
RGSC_v3.4	20	4,259,952 - 4,260,152	UniSTS	RGSC3.4
Celera	20	3,872,889 - 3,873,089	UniSTS
RH 3.4 Map	20	52.92	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH133750

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,147,793 - 4,147,984 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,366,245 - 4,366,435	NCBI	Rnor6.0
Rnor_5.0	20	6,445,601 - 6,445,791	UniSTS	Rnor5.0
RGSC_v3.4	20	4,250,257 - 4,250,447	UniSTS	RGSC3.4
Celera	20	3,882,219 - 3,882,409	UniSTS
RH 3.4 Map	20	53.3	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH94616

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,026,509 - 4,026,599 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,486,543 - 4,486,632	NCBI	Rnor6.0
Rnor_5.0	20	6,565,899 - 6,565,988	UniSTS	Rnor5.0
RGSC_v3.4	20	4,128,105 - 4,128,194	UniSTS	RGSC3.4
Celera	20	4,003,501 - 4,003,590	UniSTS
RH 3.4 Map	20	52.42	UniSTS
Cytogenetic Map	20	p12	UniSTS

BI284306

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,136,385 - 4,136,591 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,377,638 - 4,377,843	NCBI	Rnor6.0
Rnor_5.0	20	6,456,994 - 6,457,199	UniSTS	Rnor5.0
RGSC_v3.4	20	4,238,227 - 4,238,432	UniSTS	RGSC3.4
Celera	20	3,893,663 - 3,893,868	UniSTS
RH 3.4 Map	20	53.02	UniSTS
Cytogenetic Map	20	p12	UniSTS

BE113482

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,180,709 - 4,180,860 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,333,399 - 4,333,549	NCBI	Rnor6.0
Rnor_5.0	20	6,412,755 - 6,412,905	UniSTS	Rnor5.0
RGSC_v3.4	20	4,283,559 - 4,283,709	UniSTS	RGSC3.4
Celera	20	3,850,103 - 3,850,253	UniSTS
RH 3.4 Map	20	52.4	UniSTS
Cytogenetic Map	20	p12	UniSTS

BF405332

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,124,633 - 4,125,169 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,389,057 - 4,389,592	NCBI	Rnor6.0
Rnor_5.0	20	6,468,413 - 6,468,948	UniSTS	Rnor5.0
RGSC_v3.4	20	4,226,512 - 4,227,047	UniSTS	RGSC3.4
Celera	20	3,905,092 - 3,905,627	UniSTS
RH 3.4 Map	20	55.93	UniSTS
Cytogenetic Map	20	p12	UniSTS

BE115494

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,090,976 - 4,091,188 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,422,016 - 4,422,227	NCBI	Rnor6.0
Rnor_5.0	20	6,501,372 - 6,501,583	UniSTS	Rnor5.0
RGSC_v3.4	20	4,192,241 - 4,192,452	UniSTS	RGSC3.4
Celera	20	3,939,012 - 3,939,223	UniSTS
RH 3.4 Map	20	54.03	UniSTS
Cytogenetic Map	20	p12	UniSTS

BF413235

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,076,693 - 4,076,894 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,436,307 - 4,436,507	NCBI	Rnor6.0
Rnor_5.0	20	6,515,663 - 6,515,863	UniSTS	Rnor5.0
RGSC_v3.4	20	4,177,961 - 4,178,161	UniSTS	RGSC3.4
Celera	20	3,953,384 - 3,953,584	UniSTS
RH 3.4 Map	20	52.92	UniSTS
Cytogenetic Map	20	p12	UniSTS

PMC162222P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,149,485 - 4,150,413 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,363,817 - 4,364,744	NCBI	Rnor6.0
Rnor_5.0	20	6,443,173 - 6,444,100	UniSTS	Rnor5.0
RGSC_v3.4	20	4,251,948 - 4,252,875	UniSTS	RGSC3.4
Celera	20	3,879,791 - 3,880,718	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH134814

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,026,558 - 4,026,742 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,486,400 - 4,486,583	NCBI	Rnor6.0
Rnor_5.0	20	6,565,756 - 6,565,939	UniSTS	Rnor5.0
RGSC_v3.4	20	4,128,154 - 4,128,337	UniSTS	RGSC3.4
Celera	20	4,003,358 - 4,003,541	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH135211

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,136,183 - 4,136,397 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,377,832 - 4,378,045	NCBI	Rnor6.0
Rnor_5.0	20	6,457,188 - 6,457,401	UniSTS	Rnor5.0
RGSC_v3.4	20	4,238,025 - 4,238,238	UniSTS	RGSC3.4
Celera	20	3,893,857 - 3,894,070	UniSTS
RH 3.4 Map	20	53.33	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH139089

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,161,338 - 4,161,713 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,352,517 - 4,352,891	NCBI	Rnor6.0
Rnor_5.0	20	6,431,873 - 6,432,247	UniSTS	Rnor5.0
RGSC_v3.4	20	4,264,099 - 4,264,473	UniSTS	RGSC3.4
Celera	20	3,868,568 - 3,868,942	UniSTS
RH 3.4 Map	20	52.0	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH139384

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,135,796 - 4,136,000 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,378,229 - 4,378,432	NCBI	Rnor6.0
Rnor_5.0	20	6,457,585 - 6,457,788	UniSTS	Rnor5.0
RGSC_v3.4	20	4,237,638 - 4,237,841	UniSTS	RGSC3.4
Celera	20	3,894,254 - 3,894,457	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH140482

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,132,361 - 4,132,493 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,381,736 - 4,381,867	NCBI	Rnor6.0
Rnor_5.0	20	6,461,092 - 6,461,223	UniSTS	Rnor5.0
RGSC_v3.4	20	4,234,241 - 4,234,372	UniSTS	RGSC3.4
Celera	20	3,897,765 - 3,897,896	UniSTS
Cytogenetic Map	20	p12	UniSTS

AI453961

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,148,217 - 4,148,512 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,365,717 - 4,366,011	NCBI	Rnor6.0
Rnor_5.0	20	6,445,073 - 6,445,367	UniSTS	Rnor5.0
RGSC_v3.4	20	4,250,681 - 4,250,975	UniSTS	RGSC3.4
Celera	20	3,881,691 - 3,881,985	UniSTS
RH 3.4 Map	20	53.83	UniSTS
Cytogenetic Map	20	p12	UniSTS

BE119939

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,147,499 - 4,147,668 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,366,561 - 4,366,729	NCBI	Rnor6.0
Rnor_5.0	20	6,445,917 - 6,446,085	UniSTS	Rnor5.0
RGSC_v3.4	20	4,249,963 - 4,250,131	UniSTS	RGSC3.4
Celera	20	3,882,535 - 3,882,703	UniSTS
RH 3.4 Map	20	52.1	UniSTS
Cytogenetic Map	20	p12	UniSTS

AI176804

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,151,744 - 4,151,845 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,362,385 - 4,362,485	NCBI	Rnor6.0
Rnor_5.0	20	6,441,741 - 6,441,841	UniSTS	Rnor5.0
RGSC_v3.4	20	4,254,207 - 4,254,307	UniSTS	RGSC3.4
Celera	20	3,878,359 - 3,878,459	UniSTS
RH 3.4 Map	20	52.92	UniSTS
Cytogenetic Map	20	p12	UniSTS

AI013941

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,087,098 - 4,087,326 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,425,878 - 4,426,105	NCBI	Rnor6.0
Rnor_5.0	20	6,505,234 - 6,505,461	UniSTS	Rnor5.0
RGSC_v3.4	20	4,188,363 - 4,188,590	UniSTS	RGSC3.4
Celera	20	3,942,874 - 3,943,101	UniSTS
Cytogenetic Map	20	p12	UniSTS

MARC_5887-5888:991939775:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,154,572 - 4,155,304 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,358,926 - 4,359,657	NCBI	Rnor6.0
Rnor_5.0	20	6,438,282 - 6,439,013	UniSTS	Rnor5.0
RGSC_v3.4	20	4,257,035 - 4,257,766	UniSTS	RGSC3.4
Celera	20	3,874,900 - 3,875,631	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH124332

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,132,455 - 4,132,618 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,381,611 - 4,381,773	NCBI	Rnor6.0
Rnor_5.0	20	6,460,967 - 6,461,129	UniSTS	Rnor5.0
RGSC_v3.4	20	4,234,335 - 4,234,497	UniSTS	RGSC3.4
Celera	20	3,897,640 - 3,897,802	UniSTS
Cytogenetic Map	20	p12	UniSTS

UniSTS:237630

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,099,920 - 4,100,134 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,413,071 - 4,413,284	NCBI	Rnor6.0
Rnor_5.0	20	6,492,427 - 6,492,640	UniSTS	Rnor5.0
RGSC_v3.4	20	4,201,184 - 4,201,397	UniSTS	RGSC3.4
Celera	20	3,930,067 - 3,930,280	UniSTS
Cytogenetic Map	20	p12	UniSTS

UniSTS:465467

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	4,161,676 - 4,162,237 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	4,351,993 - 4,352,553	NCBI	Rnor6.0
Rnor_5.0	20	6,431,349 - 6,431,909	UniSTS	Rnor5.0
RGSC_v3.4	20	4,264,437 - 4,265,274	UniSTS	RGSC3.4
Celera	20	3,868,044 - 3,868,604	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013197	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY091791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY091792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061571	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO398403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234385	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

NM_001013197 ⟹ NP_001013215

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	4,000,216 - 4,009,743 (+)	NCBI
mRatBN7.2	20	3,995,590 - 4,005,117 (+)	NCBI
Rnor_6.0	20	4,317,440 - 4,517,128 (-)	NCBI
Rnor_5.0	20	6,396,796 - 6,596,927 (-)	NCBI
RGSC_v3.4	20	4,095,981 - 4,105,509 (+)	RGD
Celera	20	4,025,587 - 4,035,112 (-)	RGD

Sequence:

show sequence

AGACGCTATGTTCAGGAGTTCTTTCCCGGAACCCTGAAATTCGGGCTATGAATCGTAAGAGACG
TCTCCTGGCGTCTGAGGTTTTTGGAGTGAAGCGACGGCGGGTGCCGGGGCCCGTGAGAGCGGAT
CCTCTAAGGGCGGAAGCAGGTTCGGCACGCGAGGCCATCGAAGAGCTCGTGCAGCTGTTCCCAC
GGGGGCTGTTCGAGGACGCGCTGCCGCCCATCGCGCTGAGGACTCAAGTGTACAGTCTGGTGCC
GGACAGGACGGTGGCCGACCTGCAGCTGAAGGAGCTTCAAGATCGGGGAGAGATCCAAGTCATC
CAGCTAGGCTTTGACTTGGATGCCCACGGAATTGTCTTCACTGAAGACTACAGGACCAGGGTCC
TCAAGGCCTGCGATGGCCGACCATGCGCTGGGGCGGTGCAGAAGTTCCTGGCCTCGGTGCTCCC
AGCCTGTGGGGACCTTAGTTTCCAGCAGGACCAGATGACACAGACTTACGGCTTCAGGGACTCG
GAGATCACGCACCTGGTGAATGCTGGAGTCCTCACTGTCCGTGATGCTGGAAGCTGGTGGCTGG
CTGTGCCCGGAGCTGGGAGATTCATTAAGTGCTTTGTTAAAGGACGCCAGGCTGTACTGAGCAT
GGTGCGGAAGGCCAAGTACCGGGAGCTTCCCCTGTCGGAGCTCCTGGGCCGCAGAGTCCCTTCA
GCAGTGCGGCTAGGTCTTGCCTACCATGTGCATGACCTCATTGGGGCACAGCTGGTGGACTGTG
TCCCCACCACTTCTGGAACCCTCCTTCGCCTGCCAGATACGTGAGGAGTCAGCTCTTGGATTCT
TCAGCTCACTGAGCGAGGTTCCCGGACGTGCCGCCCCAGGGACTGAGCGAGGTTCCCGGACGTG
CCACCCCAGGGTGGCTGGACAAGTCACCACAGAGGGCGCAAGGCTCTGCTGCTGCAAGCTGAGG
CTCCCACCTGAGCTGGGCTGTGGGCACTGCAGCCCTTGGTTCCTTCCGTGGGACCAGGAGCCAG
GAGCCGAGCCAAGGGGATAAGAAGATGGCTGGAGACACTGGAGAAGGAAGCAGAAAACTCTGCC
CTTCACGTCAGACTGAAATTGCCAAATAAATACTTGTGCCTGCAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013215	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61571	(Get FASTA)	NCBI Sequence Viewer
	AAM14721	(Get FASTA)	NCBI Sequence Viewer
	CAE83968	(Get FASTA)	NCBI Sequence Viewer
	EDL83429	(Get FASTA)	NCBI Sequence Viewer
	EDL83430	(Get FASTA)	NCBI Sequence Viewer
	EDL83431	(Get FASTA)	NCBI Sequence Viewer
	EDL83432	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000076734.1
	ENSRNOP00000093475.1

RefSeq Acc Id:

NP_001013215 ⟸ NM_001013197

- UniProtKB:

Q6P7Q3 (UniProtKB/TrEMBL), A0A8I5ZJ96 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNRKRRLLASEVFGVKRRRVPGPVRADPLRAEAGSAREAIEELVQLFPRGLFEDALPPIALRTQ
VYSLVPDRTVADLQLKELQDRGEIQVIQLGFDLDAHGIVFTEDYRTRVLKACDGRPCAGAVQKF
LASVLPACGDLSFQQDQMTQTYGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKCFVKGR
QAVLSMVRKAKYRELPLSELLGRRVPSAVRLGLAYHVHDLIGAQLVDCVPTTSGTLLRLPDT

hide sequence

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359601	AgrOrtholog
BioCyc Gene	G2FUF-4598	BioCyc
Ensembl Genes	ENSRNOG00000048929	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000072446.4	UniProtKB/TrEMBL
	ENSRNOT00000107384.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6921289	IMAGE-MGC_LOAD
InterPro	Ser/Thr_kinase_19	UniProtKB/TrEMBL
KEGG Report	rno:361800	UniProtKB/TrEMBL
MGC_CLONE	MGC:72963	IMAGE-MGC_LOAD
NCBI Gene	361800	ENTREZGENE
PANTHER	PTHR15243	UniProtKB/TrEMBL
	SERINE/THREONINE-PROTEIN KINASE 19	UniProtKB/TrEMBL
Pfam	Stk19	UniProtKB/TrEMBL
PhenoGen	Stk19	PhenoGen
RatGTEx	ENSRNOG00000048929	RatGTEx
UniProt	A0A8I5ZJ96	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AJX3_RAT	UniProtKB/TrEMBL
	A6KTJ9_RAT	UniProtKB/TrEMBL
	A6KTK0_RAT	UniProtKB/TrEMBL
	A6KTK1_RAT	UniProtKB/TrEMBL
	A6KTK2_RAT	UniProtKB/TrEMBL
	Q6MG78_RAT	UniProtKB/TrEMBL
	Q6P7Q3	ENTREZGENE, UniProtKB/TrEMBL
	Q8R401_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Stk19	serine/threonine kinase 19			Symbol and Name status set to approved	1299863	APPROVED
2005-07-29	Stk19	serine/threonine kinase 19			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD