Vom1r11 (vomeronasal 1 receptor 11)

Gene: Vom1r11 (vomeronasal 1 receptor 11) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Vom1r11

Name:

vomeronasal 1 receptor 11

RGD ID:

1359457

Description:

Predicted to enable pheromone receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway; response to pheromone; and sensory perception of chemical stimulus. Predicted to be located in plasma membrane. Orthologous to several human genes including VN1R2 (vomeronasal 1 receptor 2).

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

LOC108348087; V1re4; vomernasal 1 receptor Vom1r11; vomeronasal 1 receptor, 11; vomeronasal 1 receptor, E4; vomeronasal type-1 receptor 4; vomeronasal type-1 receptor 4-like; vomeronasal V1r-type receptor V1re4

RGD Orthologs

Alliance Genes

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Alliance orthologs ³				less info ...
Homo sapiens (human):	VN1R3 (vomeronasal 1 receptor 3)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Homo sapiens (human):	VN1R2 (vomeronasal 1 receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Mus musculus (house mouse):	Vmn1r232 (vomeronasal 1 receptor 232)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ora1 (olfactory receptor class A related 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	68,789,122 - 68,790,163 (-)	NCBI		GRCr8
mRatBN7.2	1	60,116,228 - 60,117,175 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	60,115,306 - 60,122,768 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	60,331,979 - 60,332,899 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,331,979 - 60,332,899 (-)	NCBI	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,331,979 - 60,332,899 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,516,995 - 60,517,915 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	1	60,516,995 - 60,517,915 (-)	NCBI	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	61,682,530 - 61,683,450 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	57,986,844 - 57,987,764 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	57,989,788 - 57,990,709 (-)	NCBI
Celera	1	56,259,983 - 56,260,903 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IEA)

response to pheromone (IEA)

sensory perception of chemical stimulus (IEA)

Cellular Component

plasma membrane (IEA)

Molecular Function

pheromone receptor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19952141

Genomics

Variants

Variants in Vom1r11
4 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111897	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000078071 ⟹ ENSRNOP00000070250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	60,516,995 - 60,517,915 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000078636 ⟹ ENSRNOP00000069085

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	60,331,979 - 60,332,899 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110551 ⟹ ENSRNOP00000081078

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	60,115,860 - 60,122,768 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113636 ⟹ ENSRNOP00000086131

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	60,115,306 - 60,122,768 (-)	Ensembl

RefSeq Acc Id:

XM_017590547 ⟹ XP_017446036

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	68,789,122 - 68,790,163 (-)	NCBI
mRatBN7.2	1	60,116,228 - 60,117,175 (-)	NCBI

Sequence:

show sequence

TTAAAGGGAAAATTGCTGCATGACCTAATGGAGTACAGGAACATGGCAATAGGAATAGGACTCT
CATTTCAGAGTATATTTGGTATTCTGGGAAATTTCTCTCTTCTTTTCTACTATCTAACTCTTTA
CTACAATGAACACACAATAAAGATCATAGACATGATTCTTATACATGTGTTCACATCTAACTCT
TTGATCATTATCTCCAAAGGACTCCCCCAGATAATGGGGGCTTTTGGGTGGAACCAGTTATTCA
ATGATGTTGGGTGCAAACTTATTTTATATGTTCAAAGACTTGGCAGGAACATGTCTATCATCAC
CACTTGTCTCTTGAGTGTCTTCCAGGCAATCACCGTCAGCCCCACGAATTCCCACTGGAAGAAA
TTTAAAGTCAAATCAACGAAGTTTATAGGCTTGTCCATTTCTCTTTTCTGGATCTTGTTTATGC
TAGTAAATATGCTTTTCCCTGTGTATACATCTACCAAGATGAATAGTAAAAACAAGACCCAAAA
GAGAGATTCTGAATTCTGCCATTCTCTAGGCCGTGACAGAATAGTAGACTTACTGTATACCGCA
TTTTGTGTGTTTCCTGAACTTGTGTTTTCTCTGCTCATTGTATGTTCTAGCACCTTCATGATTA
TAATACTTTATGTACACAAAAAGAGGGTGCAACACATTCTCTATGCTCACCCTTCTCCAAGAAG
CTCCCCTGAAAACAGAGCCACACAGACCATCTTGATTCTTGTTTGCACCTTTCTAGCATTTTAT
ACACTTTCTTCAATTTTACAAGGCTATATTGTTCTTTCACATGATCCCAGTTGGTGGGTAATGA
ATACCACAGCCATCATTTCTATGTGTTTCCCTACTTTAGGCCCATTTGTGATGAGTCGCGATTT
CACTGTTTCCAAATTCTGCTGTACTTGGATAAGAAATATAGAAAAATCATGA

hide sequence

Protein Sequences


Protein RefSeqs	XP_017446036	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000081078
	ENSRNOP00000081078.1
	ENSRNOP00000086131.1

RefSeq Acc Id:

XP_017446036 ⟸ XM_017590547

- UniProtKB:

Q5J3L9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEYRNMAIGIGLSFQSIFGILGNFSLLFYYLTLYYNEHTIKIIDMILIHVFTSNSLIIISKGLP
QIMGAFGWNQLFNDVGCKLILYVQRLGRNMSIITTCLLSVFQAITVSPTNSHWKKFKVKSTKFI
GLSISLFWILFMLVNMLFPVYTSTKMNSKNKTQKRDSEFCHSLGRDRIVDLLYTAFCVFPELVF
SLLIVCSSTFMIIILYVHKKRVQHILYAHPSPRSSPENRATQTILILVCTFLAFYTLSSILQGY
IVLSHDPSWWVMNTTAIISMCFPTLGPFVMSRDFTVSKFCCTWIRNIEKS

hide sequence

RefSeq Acc Id:

ENSRNOP00000069085 ⟸ ENSRNOT00000078636

RefSeq Acc Id:

ENSRNOP00000070250 ⟸ ENSRNOT00000078071

RefSeq Acc Id:

ENSRNOP00000081078 ⟸ ENSRNOT00000110551

RefSeq Acc Id:

ENSRNOP00000086131 ⟸ ENSRNOT00000113636

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5J3L9-F1-model_v2	AlphaFold	Q5J3L9	1-306	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359457	AgrOrtholog
BioCyc Gene	G2FUF-61212	BioCyc
Ensembl Genes	ENSRNOG00000056833	Ensembl
	ENSRNOG00000060271	Ensembl
	ENSRNOG00000066108	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000110551.1	UniProtKB/TrEMBL
	ENSRNOT00000113636.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Vmron_rcpt_1	UniProtKB/TrEMBL
KEGG Report	rno:494300	UniProtKB/TrEMBL
NCBI Gene	494300	ENTREZGENE
PANTHER	PTHR24062	UniProtKB/TrEMBL
	VOMERONASAL TYPE-1 RECEPTOR	UniProtKB/TrEMBL
Pfam	V1R	UniProtKB/TrEMBL
PhenoGen	Vom1r11	PhenoGen
PRINTS	VOMERONASL1R	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000056833	RatGTEx
	ENSRNOG00000060271	RatGTEx
	ENSRNOG00000066108	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	Q5J3L9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-06-02	Vom1r11	vomeronasal 1 receptor 11	Vom1r11	vomeronasal 1 receptor 11	Data merged from RGD:149736381	737654	PROVISIONAL
2021-08-09	Vom1r11	vomeronasal 1 receptor 11			Symbol and Name status set to provisional	45752	PROVISIONAL
2021-03-09	Vom1r11	vomeronasal 1 receptor 11	LOC108348087	vomeronasal type-1 receptor 4-like	Data merged from RGD:11373673	737654	PROVISIONAL
2016-08-02	LOC108348087	vomeronasal type-1 receptor 4-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-06-08	Vom1r11	vomeronasal 1 receptor, 11	V1re4	vomeronasal 1 receptor, E4	Symbol and Name updated	2325755	APPROVED
2008-03-04	V1re4	vomeronasal 1 receptor, E4	V1re4	vomeronasal V1r-type receptor V1re4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	V1re4	vomeronasal V1r-type receptor V1re4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message