Eif4h (eukaryotic translation initiation factor 4H)

Advanced Search (OLGA)

Gene: Eif4h (eukaryotic translation initiation factor 4H) Rattus norvegicus

Analyze

Symbol:

Eif4h

Name:

eukaryotic translation initiation factor 4H

RGD ID:

1359222

Description:

Predicted to enable RNA strand annealing activity; RNA strand-exchange activity; and ribosomal small subunit binding activity. Predicted to be involved in eukaryotic translation initiation factor 4F complex assembly and formation of translation preinitiation complex. Predicted to act upstream of or within developmental growth and sexual reproduction. Predicted to be located in perinuclear region of cytoplasm. Human ortholog(s) of this gene implicated in Williams-Beuren syndrome. Orthologous to human EIF4H (eukaryotic translation initiation factor 4H); PARTICIPATES IN translation initiation pathway; INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

eIF-4H; MGC94887; Wbscr1; williams-Beuren syndrome chromosomal region 1 protein homolog; Williams-Beuren syndrome chromosome region 1 homolog; Williams-Beuren syndrome chromosome region 1 homolog (human)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EIF4H (eukaryotic translation initiation factor 4H)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Eif4h (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Eif4h (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EIF4H (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EIF4H (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EIF4H (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EIF4H (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Eif4h (eukaryotic translation initiation factor 4H)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	EIF4H (eukaryotic translation initiation factor 4H)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Eif4h (eukaryotic translation initiation factor 4H)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	eif4h (eukaryotic translation initiation factor 4h)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	drr-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder)
Drosophila melanogaster (fruit fly):	eIF4H1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	eIF4H2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	eif4h	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,719,527 - 27,736,350 (+)	NCBI		GRCr8
mRatBN7.2	12	22,083,155 - 22,099,876 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	22,082,835 - 22,099,876 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	23,226,405 - 23,243,089 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,837,491 - 23,854,172 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,903,979 - 22,920,627 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	25,093,119 - 25,109,805 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	25,093,149 - 25,109,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	27,093,323 - 27,110,202 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	23,148,332 - 23,164,980 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	23,008,888 - 23,025,536 (+)	NCBI
Celera	12	23,847,161 - 23,863,817 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

autistic disorder (ISO)

intestinal volvulus (ISO)

Neurodevelopmental Disorders (ISO)

pleomorphic xanthoastrocytoma (ISO)

schizophrenia (ISO)

supravalvular aortic stenosis (ISO)

Volvulus Of Midgut (ISO)

Williams-Beuren syndrome (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2,6-dimethoxyphenol (ISO)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

5-fluorouracil (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aldehydo-D-glucose (ISO)

aloxistatin (ISO)

amiodarone (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

caffeine (ISO)

calcidiol (EXP)

carbon nanotube (ISO)

cefaloridine (EXP)

chloropicrin (ISO)

chloroquine (ISO)

chlorpyrifos (ISO)

choline (ISO)

clofibrate (EXP)

corosolic acid (ISO)

CU-O LINKAGE (ISO)

cytarabine (ISO)

D-glucose (ISO)

dexamethasone (ISO)

diallyl trisulfide (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

furfural (ISO)

glucose (ISO)

indometacin (ISO)

ivermectin (ISO)

L-ethionine (EXP)

L-methionine (ISO)

leupeptin (ISO)

N-methyl-4-phenylpyridinium (ISO)

nitrates (ISO)

omeprazole (EXP)

paracetamol (ISO)

paraquat (ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (EXP,ISO)

propiconazole (ISO)

quizartinib (ISO)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

tanespimycin (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

vinclozolin (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

developmental growth (ISO)

eukaryotic translation initiation factor 4F complex assembly (IBA)

formation of translation preinitiation complex (IBA)

sexual reproduction (ISO)

translational initiation (IEA)

Cellular Component

perinuclear region of cytoplasm (IEA)

Molecular Function

protein binding (ISO)

ribosomal small subunit binding (IBA)

RNA binding (IEA)

RNA strand annealing activity (IBA)

RNA strand-exchange activity (IBA)

translation initiation factor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

translation initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Comparative genomic sequence analysis of the Williams syndrome region (LIMK1-RFC2) of human chromosome 7q11.23.	Martindale DW, etal., Mamm Genome 2000 Oct;11(10):890-8.
3.	Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients.	Osborne LR, etal., Genomics. 1996 Sep 1;36(2):328-36.
4.	mRNA helicases: the tacticians of translational control.	Parsyan A, etal., Nat Rev Mol Cell Biol. 2011 Apr;12(4):235-45. doi: 10.1038/nrm3083.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Purification and characterization of a new eukaryotic protein translation factor. Eukaryotic initiation factor 4H.	Richter-Cook NJ, etal., J Biol Chem 1998 Mar 27;273(13):7579-87.
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:15489334	PMID:19946888	PMID:22234171	PMID:22658674	PMID:22681889	PMID:25468996

Genomics

Comparative Map Data

Eif4h
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,719,527 - 27,736,350 (+)	NCBI		GRCr8
mRatBN7.2	12	22,083,155 - 22,099,876 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	22,082,835 - 22,099,876 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	23,226,405 - 23,243,089 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,837,491 - 23,854,172 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,903,979 - 22,920,627 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	25,093,119 - 25,109,805 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	25,093,149 - 25,109,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	27,093,323 - 27,110,202 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	23,148,332 - 23,164,980 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	23,008,888 - 23,025,536 (+)	NCBI
Celera	12	23,847,161 - 23,863,817 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

EIF4H
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	74,174,356 - 74,197,096 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	74,174,231 - 74,197,122 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	73,588,686 - 73,611,426 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	73,226,642 - 73,249,365 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	73,033,356 - 73,056,080	NCBI
Celera	7	69,068,153 - 69,090,994 (+)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	69,470,180 - 69,492,897 (+)	NCBI		HuRef
CHM1_1	7	73,733,792 - 73,756,510 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	75,376,368 - 75,399,096 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,921,778 - 72,944,501 (+)	NCBI

Eif4h
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	134,648,726 - 134,668,263 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	134,648,575 - 134,668,344 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	134,619,872 - 134,639,409 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	134,619,721 - 134,639,490 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,095,746 - 135,115,198 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	134,904,503 - 134,923,955 (-)	NCBI		MGSCv36	mm8
Celera	5	131,627,926 - 131,647,368 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.71	NCBI

Eif4h
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	13,699,012 - 13,725,393 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955456	13,699,012 - 13,710,065 (-)	NCBI	ChiLan1.0	ChiLan1.0

EIF4H
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	90,700,764 - 90,725,147 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	138,965,396 - 138,989,418 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	81,339,091 - 81,348,585 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	81,336,947 - 81,348,585 (+)	Ensembl	panpan1.1		panPan2

EIF4H
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,180,189 - 6,202,835 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	6,181,827 - 6,207,116 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	7,878,270 - 7,905,406 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	5,994,613 - 6,021,884 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	5,994,619 - 6,021,897 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	5,985,558 - 6,012,686 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	5,933,300 - 5,960,439 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,096,813 - 6,123,967 (-)	NCBI		UU_Cfam_GSD_1.0

EIF4H
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	11,320,797 - 11,348,473 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	11,321,486 - 11,348,473 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	11,003,785 - 11,031,697 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EIF4H
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	8,878,250 - 8,903,812 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	8,879,946 - 8,903,828 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	7,674,083 - 7,700,226 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eif4h
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	13,779,024 - 13,801,809 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	13,779,387 - 13,801,679 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Eif4h
142 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	231
Count of miRNA genes:	151
Interacting mature miRNAs:	187
Transcripts:	ENSRNOT00000050059
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	8525423	28064601	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	23297788	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
10755457	Coatc14	Coat color QTL 14		0.01759	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	12	1	22591684	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
1300157	Rf21	Renal function QTL 21	4.4		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	12	9318216	32103380	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	28064557	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	19610870	24139202	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1581516	Cm56	Cardiac mass QTL 56	4.2	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	1	29333307	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	11073825	24234895	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	13635523	30827399	Rat
631521	Pia12	Pristane induced arthritis QTL 12	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	20259417	23672083	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	8449490	28302290	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

Markers in Region

RH128254

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	27,735,958 - 27,736,186 (+)	Marker Load Pipeline
mRatBN7.2	12	22,099,484 - 22,099,712 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	25,109,414 - 25,109,641	NCBI	Rnor6.0
Rnor_5.0	12	27,109,811 - 27,110,038	UniSTS	Rnor5.0
RGSC_v3.4	12	23,164,589 - 23,164,816	UniSTS	RGSC3.4
Celera	12	23,863,426 - 23,863,653	UniSTS
RH 3.4 Map	12	349.1	UniSTS
Cytogenetic Map	12	q12	UniSTS

D5Ertd355e

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	22,099,620 - 22,099,868 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	25,109,550 - 25,109,797	NCBI	Rnor6.0
Rnor_5.0	12	27,109,947 - 27,110,194	UniSTS	Rnor5.0
RGSC_v3.4	12	23,164,725 - 23,164,972	UniSTS	RGSC3.4
Celera	12	23,863,562 - 23,863,809	UniSTS
Cytogenetic Map	12	q12	UniSTS

AU046599

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	27,718,285 - 27,718,470 (+)	Marker Load Pipeline
mRatBN7.2	12	22,081,808 - 22,081,993 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	25,091,743 - 25,091,927	NCBI	Rnor6.0
Rnor_5.0	12	27,092,140 - 27,092,324	UniSTS	Rnor5.0
RGSC_v3.4	12	23,146,918 - 23,147,102	UniSTS	RGSC3.4
Celera	12	23,845,755 - 23,845,939	UniSTS
Cytogenetic Map	12	q12	UniSTS

Wbscr1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	27,733,993 - 27,734,652 (+)	Marker Load Pipeline
mRatBN7.2	12	22,097,517 - 22,098,178 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	25,107,449 - 25,108,107	NCBI	Rnor6.0
Rnor_5.0	12	27,107,846 - 27,108,504	UniSTS	Rnor5.0
RGSC_v3.4	12	23,162,624 - 23,163,282	UniSTS	RGSC3.4
Celera	12	23,861,461 - 23,862,119	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001006957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC135741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083818	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB718613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050059 ⟹ ENSRNOP00000043254

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	22,092,189 - 22,099,876 (+)	Ensembl
Rnor_6.0 Ensembl	12	25,093,149 - 25,109,799 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000081084 ⟹ ENSRNOP00000075555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	22,082,835 - 22,099,876 (+)	Ensembl
Rnor_6.0 Ensembl	12	25,093,524 - 25,108,174 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113874 ⟹ ENSRNOP00000084867

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	22,082,835 - 22,099,867 (+)	Ensembl

RefSeq Acc Id:

NM_001006957 ⟹ NP_001006958

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,719,692 - 27,736,350 (+)	NCBI
mRatBN7.2	12	22,083,215 - 22,099,876 (+)	NCBI
Rnor_6.0	12	25,093,149 - 25,109,805 (+)	NCBI
Rnor_5.0	12	27,093,323 - 27,110,202 (+)	NCBI
RGSC_v3.4	12	23,148,332 - 23,164,980 (+)	RGD
Celera	12	23,847,161 - 23,863,817 (+)	NCBI

Sequence:

show sequence

CGCTGGCCCGCTGGTTCCTCAAGGAGCGGAGACGGCAAATGGCGGACTTCGATACCTACGACGA
TCGGGCCTACAGCAGCTTCGGCGGCGGTAGAGGGTCCCGCGGCAGTGCTGGTGGCCATGGGTCC
CGAAGCCAGAAGGAGCTACCCACAGAGCCCCCCTACACAGCTTACGTAGGAAATCTCCCTTTTA
ACACAGTTCAGGGTGACATAGATGCTATCTTTAAGGATCTCAGCATACGGAGTGTGCGGCTAGT
CAGAGACAAAGACACAGACAAATTTAAAGGGTTCTGCTATGTAGAATTTGATGAGGTGGATTCC
CTGAAGGAGGCTCTGACCTACGACGGTGCACTCTTGGGTGACCGGTCACTTCGTGTGGACATTG
CAGAAGGCAGAAAACAAGACAAAGGTGGCTTTGGGTTCAGGAAAGGCGGACCTGATGACAGAGG
AATGGGTGGCTCTCGAGAACCGAGAGGTGGATGGGATTCCCGGGATGACTTCAGCTCTGGCTAC
AGGGATGACTTCTTAGGGGGTAGGGGGGGCAGTCGCCCTGGGGACCGGCGAGCAGGCCCTCCAA
TGGGGAGTCGCTTTCGAGATGGCCCTCCTCTGCGTGGCTCCAACATGGACTTCAGAGAACCCAC
AGAAGAGGAACGAGCACAGAGACCGCGGCTGCAGCTTAAACCTCGGACAGTGGCAACACCCCTC
AATCAAGTAGCCAACCCCAACTCAGCCATCTTCGGGGGAGCCAGGCCCAGAGAGGAAGTGGTTC
AGAAGGAGCAAGAATGAGCTTAGGTTGGGAGGGAATGGGGTGTGGGGGAGCTGGAGCAAGAGCA
CAGCCTGGTGGCAGGCAGTCGCCCTGCAGGCCCCATTCCCGCCTGGCACTGTCCTCCTTACAGC
GGGAACACAGAGCTTGCGAGTGCATGTCAGCTGTTAACAAGTGGTTTCTAGTACATTCTTGGCT
TTGCTGTATCTATCTAGTGCCTGTTTTGTGCTTTCTTTCTGTTTTCTTTCTCTCCCCTCTCACT
CCTGGCCTCTCCCTGCTCCTTCCCACGCCGTGTGGATGTCGGTCACGTGTGGAAGGTGGGCTGA
GGTGCCTCATCCTTTGCTTTCTTTCTTTCCTTTCCGCGCCCTGGCCACGCTCCGGGTGTGCTGT
CCTCTGCTTTTTCTCAGAGCTTCTCTCCAATCTGCATGTCGAGTTCTGTGTTGCTGTGGCTTCT
GGGAAAGAGCTGGGGCCACTAGCTAGGCGGCTGTGGTGGCCTGTTGGTAGGTATCCAGCTGGGA
TGAGCACACAGAATTGGAGGCATCTTGCTTTAAAACAAGGAAACTGCCTTCTGGTCCCGAGAGG
CTGCTGTGTTTGGGGTCAGTCACCTGCCCCAAGCAGCCTGTTCAGGTATAGCAGGCTCCTGTCA
AACAGTGAGGCCAGAAGGGTGCAGGGAATTGGGACATTCTGCTCTGGTGGCTCTGGGTGCCAGT
GGCCATGTGGCTTTGCTCCTGCTCGCTCTAAGACCAAGTGGAAGCTCATTCCCTGCTCTTCCTG
GGCCGTGGAGGCCCCTTGGGGGTGCAACCCGCTGCAGCTCAATCCGCTTCCTGCAGCCGAGGCC
TGTAGGAAGCAGGGGTGGTGCTGGAGCTGCACCGGGCAGCTGTGCCTGCACTGAGTCTGCGCTC
TTTCCCTTGTGTCTGTCTGCTCCAGGGCGCTTAGCCCAAAAGGCTGCTCCCCACCACAGCTCAA
GGCCTAGAGTCTGGCACTTTCTCTGATCGGTTGCACAGCTGTTGAGAACCTCAGTACCTGGGTG
TCTAGAAACCTCTAGGCTTGCTGCTTGCTCTGTGGGGCAGACCCTGCTCCCACAGACAGTGCTG
AGCACTCACTTGAGAGCAAGGGGATCAATCAGGCTTTGCTTTAGCTCGGACAGCTGTGTGTGAA
CAAATGGAAAGTGATTTGGCACCGAGTCTCCATCTGTTCCAGTCGGAGCAGGTAGGGGTCAGCC
AGCCACTAGAGCCTTGGGAAAGAAGGGCTGAGGTGCGCAGCTTGCTCGTTAGCCAGCAGCTTCC
TGCCAGCCACCCCTTGGCTCATGATTGTCTTTGTCGCAAGGTCTCGGCAATTTACAGAACTCTC
ACTCCTTCCCTCGCCTGCCATCTTCTCTGCTTCTGAGATAAGAACCATTTGTGTAACACCAATA
CCTAACTTAAGACAGACATGCATTGCGTGGTTGTAATCAAAGCTGATGCTTTCAGATGATCTAA
TCCATCTCCAATGCGGAAAAGACAGAACAGGCACGTCCATCCACACTGCTGGGCGCCCAGCTGA
CTCTGTAAGAATGGAATTCCAAACACTTAACACATTCAGTTCTATGACAGAAAGTGAGTCTATG
GATATGGTATTTTGTGAATGATCTTTTAAATAAAAGAGAACCTTACATAACAAAAAAAAAAAAA
AAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006249134 ⟹ XP_006249196

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,719,527 - 27,736,350 (+)	NCBI
mRatBN7.2	12	22,083,155 - 22,099,870 (+)	NCBI
Rnor_6.0	12	25,093,119 - 25,108,336 (+)	NCBI
Rnor_5.0	12	27,093,323 - 27,110,202 (+)	NCBI

Sequence:

show sequence

GAGGAGGAGTTATATTGCGGGGTCCTTCCTCGCTGGCCCGCTGGTTCCTCAAGGAGCGGAGACG
GCAAATGGCGGACTTCGATACCTACGACGATCGGGCCTACAGCAGCTTCGGCGGCGGTAGAGGG
TCCCGCGGCAGTGCTGGTGGCCATGGGTCCCGAAGCCAGAAGGAGCTACCCACAGAGCCCCCCT
ACACAGCTTACGTAGGAAATCTCCCTTTTAACACAGTTCAGGGTGACATAGATGCTATCTTTAA
GGATCTCAGCATACGGAGTGTGCGGCTAGTCAGAGACAAAGACACAGACAAATTTAAAGGGTTC
TGCTATGTAGAATTTGATGAGGTGGATTCCCTGAAGGAGGCTCTGACCTACGACGGTGCACTCT
TGGGTGACCGGTCACTTCGTGTGGACATTGCAGAAGGCAGAAAACAAGACAAAGGTGGCTTTGG
GTTCAGGAAAGGCGGACCTGATGACAGAGGCTACAGGGATGACTTCTTAGGGGGTAGGGGGGGC
AGTCGCCCTGGGGACCGGCGAGCAGGCCCTCCAATGGGGAGTCGCTTTCGAGATGGCCCTCCTC
TGCGTGGCTCCAACATGGACTTCAGAGAACCCACAGAAGAGGAACGAGCACAGAGACCGCGGCT
GCAGCTTAAACCTCGGACAGTGGCAACACCCCTCAATCAAGTAGCCAACCCCAACTCAGCCATC
TTCGGGGGAGCCAGGCCCAGAGAGGAAGTGGTTCAGAAGGAGCAAGAATGAGCTTAGGTTGGGA
GGGAATGGGGTGTGGGGGAGCTGGAGCAAGAGCACAGCCTGGTGGCAGGCAGTCGCCCTGCAGG
CCCCATTCCCGCCTGGCACTGTCCTCCTTACAGCGGGAACACAGAGCTTGCGAGTGCATGTCAG
CTGTTAACAAGTGGTTTCTAGTACA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001006958	(Get FASTA)	NCBI Sequence Viewer
	XP_006249196	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83818	(Get FASTA)	NCBI Sequence Viewer
	EDM13418	(Get FASTA)	NCBI Sequence Viewer
	EDM13419	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000043254.4
	ENSRNOP00000075555.2
	ENSRNOP00000084867.1
GenBank Protein	Q5XI72	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001006958 ⟸ NM_001006957

- UniProtKB:

Q5XI72 (UniProtKB/Swiss-Prot), A0A8L2QL20 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKD
LSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGF
RKGGPDDRGMGGSREPRGGWDSRDDFSSGYRDDFLGGRGGSRPGDRRAGPPMGSRFRDGPPLRG
SNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

hide sequence

RefSeq Acc Id:	XP_006249196 ⟸ XM_006249134
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QL20 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKD LSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGF RKGGPDDRGYRDDFLGGRGGSRPGDRRAGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQ LKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE hide sequence

Ensembl Acc Id:

ENSRNOP00000075555 ⟸ ENSRNOT00000081084

Ensembl Acc Id:

ENSRNOP00000043254 ⟸ ENSRNOT00000050059

Ensembl Acc Id:

ENSRNOP00000084867 ⟸ ENSRNOT00000113874

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XI72-F1-model_v2	AlphaFold	Q5XI72	1-248	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698568

Promoter ID:

EPDNEW_R9093

Type:

initiation region

Name:

Eif4h_1

Description:

eukaryotic translation initiation factor 4H

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	25,093,158 - 25,093,218	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359222	AgrOrtholog
BioCyc Gene	G2FUF-19581	BioCyc
Ensembl Genes	ENSRNOG00000001454	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050059.5	UniProtKB/TrEMBL
	ENSRNOT00000081084.2	UniProtKB/TrEMBL
	ENSRNOT00000113874.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7110979	IMAGE-MGC_LOAD
InterPro	eIF4H_RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:288599	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94887	IMAGE-MGC_LOAD
NCBI Gene	288599	ENTREZGENE
PANTHER	EUKARYOTIC TRANSLATION INITIATION FACTOR 4B/4H	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EUKARYOTIC TRANSLATION INITIATION FACTOR 4H	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RRM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Eif4h	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001454	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2KAW7_RAT	UniProtKB/TrEMBL
	A0A8I5ZYY8_RAT	UniProtKB/TrEMBL
	A0A8L2QL20	ENTREZGENE, UniProtKB/TrEMBL
	IF4H_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-04	Eif4h	eukaryotic translation initiation factor 4H	Wbscr1	Williams-Beuren syndrome chromosome region 1 homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Wbscr1	Williams-Beuren syndrome chromosome region 1 homolog (human)		eukaryotic translation initiation factor 4H	Name updated	1299863	APPROVED
2005-07-29	Wbscr1	eukaryotic translation initiation factor 4H			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

RGD Manual Annotations