CTAG1B (cancer/testis antigen 1B)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: CTAG1B (cancer/testis antigen 1B) Homo sapiens

Analyze

No known orthologs.

Symbol:

CTAG1B

Name:

cancer/testis antigen 1B

RGD ID:

1353571

HGNC Page

HGNC

Description:

Exhibits identical protein binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II and tRNA threonylcarbamoyladenosine metabolic process. Localizes to cytoplasm.

Type:

protein-coding

RefSeq Status:

REVIEWED

Also known as:

autoimmunogenic cancer/testis antigen NY-ESO-1; cancer antigen 3; cancer/testis antigen 1; cancer/testis antigen 6.1; CT6.1; CTAG; CTAG1; CTAG1A; ESO1; l antigen family member 2; LAGE-2; LAGE2B; New York esophageal squamous cell carcinoma 1; NY-ESO-1

RGD Orthologs

Alliance Genes

More Info

homologs ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	X	154,617,609 - 154,619,282 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	X	154,617,609 - 154,619,282 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	X	153,845,865 - 153,847,533 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	153,499,059 - 153,500,714 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	X	153,409,569 - 153,411,224	NCBI
Celera	X	154,005,869 - 154,007,526 (-)	NCBI
Cytogenetic Map	X	q28	NCBI
HuRef	X	142,391,018 - 142,392,145 (-)	NCBI		HuRef
CHM1_1	X	153,757,593 - 153,759,255 (-)	NCBI		CHM1_1

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adrenoleukodystrophy (IAGP)

autistic disorder (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

5-aza-2'-deoxycytidine (EXP)

aripiprazole (EXP)

ozone (EXP)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of transcription by RNA polymerase II (IBA)

tRNA threonylcarbamoyladenosine metabolic process (IBA)

Cellular Component

cytoplasm (IDA)

Molecular Function

identical protein binding (IPI)

protein binding (IPI)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Schizophrenia (IAGP)

References

References - curated


1.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9050879	PMID:9605863	PMID:9626360	PMID:9759882	PMID:10523621	PMID:10901371	PMID:11120859	PMID:11256614	PMID:11351307	PMID:11397121	PMID:11709543	PMID:11782380
PMID:12065688	PMID:12138174	PMID:12209997	PMID:12445278	PMID:12452034	PMID:12477932	PMID:12853579	PMID:12889868	PMID:14503968	PMID:14522938	PMID:14559844	PMID:14583496
PMID:15026363	PMID:15069548	PMID:15240519	PMID:15252201	PMID:15475443	PMID:15521719	PMID:15671442	PMID:15772651	PMID:16114059	PMID:16140944	PMID:16596224	PMID:16751374
PMID:16951317	PMID:17023585	PMID:17137291	PMID:17208940	PMID:17488334	PMID:17625806	PMID:17640060	PMID:18396787	PMID:18923710	PMID:18982744	PMID:19030781	PMID:19155470
PMID:19212631	PMID:19380770	PMID:19531622	PMID:19728336	PMID:19795170	PMID:20044626	PMID:20053942	PMID:20368442	PMID:20591578	PMID:20733200	PMID:21131422	PMID:21247062
PMID:21556122	PMID:21873635	PMID:21900253	PMID:21933959	PMID:22323448	PMID:22388761	PMID:22529253	PMID:22936067	PMID:23312906	PMID:23454162	PMID:23599152	PMID:23645764
PMID:23923079	PMID:24103781	PMID:24290058	PMID:24482145	PMID:24744590	PMID:24777967	PMID:24777968	PMID:24789172	PMID:24811699	PMID:25078248	PMID:25412843	PMID:25416956
PMID:25954764	PMID:26191258	PMID:26324743	PMID:26413775	PMID:26903513	PMID:27070449	PMID:27140836	PMID:27466502	PMID:27793776	PMID:27993576	PMID:28105694	PMID:28536262
PMID:28677424	PMID:28716148	PMID:29058035	PMID:29480665	PMID:30384365	PMID:30953385	PMID:31095042	PMID:31158427	PMID:31227504	PMID:31391242	PMID:32296183	PMID:32600281

Genomics

Position Markers

DXS1073

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,908 - 153,829,128	UniSTS	GRCh37
Build 36	X	153,482,102 - 153,482,322	RGD	NCBI36
Celera	X	153,988,914 - 153,989,132	RGD
Cytogenetic Map	X	q27	UniSTS
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,111 - 142,374,331	UniSTS
Marshfield Genetic Map	X	102.35	UniSTS
Marshfield Genetic Map	X	102.35	RGD
Genethon Genetic Map	X	196.5	UniSTS
deCODE Assembly Map	X	188.22	UniSTS

ECD03314

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,141 - 153,828,940	UniSTS	GRCh37
Build 36	X	153,481,335 - 153,482,134	RGD	NCBI36
Celera	X	153,988,147 - 153,988,946	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,344 - 142,374,143	UniSTS

ECD03580

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,827,278 - 153,828,068	UniSTS	GRCh37
Build 36	X	153,480,472 - 153,481,262	RGD	NCBI36
Celera	X	153,987,284 - 153,988,074	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,372,481 - 142,373,271	UniSTS

ECD04818

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,832,469 - 153,833,222	UniSTS	GRCh37
Build 36	X	153,485,663 - 153,486,416	RGD	NCBI36
Celera	X	153,992,473 - 153,993,226	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,672 - 142,378,425	UniSTS

ECD08940

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,847,951 - 153,848,592	UniSTS	GRCh37
GRCh37	X	153,812,348 - 153,812,989	UniSTS	GRCh37
Build 36	X	153,465,542 - 153,466,183	RGD	NCBI36
Celera	X	153,972,274 - 153,972,915	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,392,574 - 142,393,215	UniSTS

ECD09418

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,768 - 153,825,397	UniSTS	GRCh37
Build 36	X	153,477,962 - 153,478,591	RGD	NCBI36
Celera	X	153,984,775 - 153,985,404	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,972 - 142,370,601	UniSTS

ECD10017

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,108 - 153,824,721	UniSTS	GRCh37
Build 36	X	153,477,302 - 153,477,915	RGD	NCBI36
Celera	X	153,984,115 - 153,984,728	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,312 - 142,369,925	UniSTS

ECD10271

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,847,236 - 153,847,842	UniSTS	GRCh37
GRCh37	X	153,813,098 - 153,813,704	UniSTS	GRCh37
Build 36	X	153,466,292 - 153,466,898	RGD	NCBI36
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,391,859 - 142,392,465	UniSTS

ECD10991

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,170 - 153,830,755	UniSTS	GRCh37
Build 36	X	153,483,364 - 153,483,949	RGD	NCBI36
Celera	X	153,990,174 - 153,990,759	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,375,373 - 142,375,958	UniSTS

ECD11531

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,932 - 153,821,501	UniSTS	GRCh37
Build 36	X	153,474,126 - 153,474,695	RGD	NCBI36
Celera	X	153,980,939 - 153,981,508	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,366,136 - 142,366,705	UniSTS

ECD13187

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,846,048 - 153,846,572	UniSTS	GRCh37
GRCh37	X	153,814,368 - 153,814,892	UniSTS	GRCh37
Build 36	X	153,467,562 - 153,468,086	RGD	NCBI36
Celera	X	154,006,052 - 154,006,576	RGD
Cytogenetic Map	X	q28	UniSTS

ECD13456

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,539 - 153,830,056	UniSTS	GRCh37
Build 36	X	153,482,733 - 153,483,250	RGD	NCBI36
Celera	X	153,989,543 - 153,990,060	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,742 - 142,375,259	UniSTS

ECD13664

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,800 - 153,831,312	UniSTS	GRCh37
Build 36	X	153,483,994 - 153,484,506	RGD	NCBI36
Celera	X	153,990,804 - 153,991,316	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,003 - 142,376,515	UniSTS

ECD14025

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,822,713 - 153,823,216	UniSTS	GRCh37
Build 36	X	153,475,907 - 153,476,410	RGD	NCBI36
Celera	X	153,982,720 - 153,983,223	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,917 - 142,368,420	UniSTS

ECD14189

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,012 - 153,829,511	UniSTS	GRCh37
Build 36	X	153,482,206 - 153,482,705	RGD	NCBI36
Celera	X	153,989,016 - 153,989,515	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,215 - 142,374,714	UniSTS

ECD16916

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,950 - 153,835,370	UniSTS	GRCh37
Build 36	X	153,488,144 - 153,488,564	RGD	NCBI36
Celera	X	153,994,954 - 153,995,374	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,153 - 142,380,573	UniSTS

ECD19575

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,878,614 - 153,878,931	UniSTS	GRCh37
GRCh37	X	153,836,355 - 153,836,672	UniSTS	GRCh37
Build 36	X	153,489,549 - 153,489,866	RGD	NCBI36
Celera	X	153,996,359 - 153,996,676	RGD
Celera	X	154,036,695 - 154,037,012	UniSTS
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,559 - 142,381,876	UniSTS
HuRef	X	142,423,237 - 142,423,554	UniSTS

ECD20147

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,917 - 153,822,212	UniSTS	GRCh37
Build 36	X	153,475,111 - 153,475,406	RGD	NCBI36
Celera	X	153,981,924 - 153,982,219	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,121 - 142,367,416	UniSTS

ECD20832

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,990 - 153,832,260	UniSTS	GRCh37
Build 36	X	153,485,184 - 153,485,454	RGD	NCBI36
Celera	X	153,991,994 - 153,992,264	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,193 - 142,377,463	UniSTS

ECD20854

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,126 - 153,834,395	UniSTS	GRCh37
Build 36	X	153,487,320 - 153,487,589	RGD	NCBI36
Celera	X	153,994,130 - 153,994,399	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,379,329 - 142,379,598	UniSTS

ECD21943

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,126 - 153,820,360	UniSTS	GRCh37
Build 36	X	153,473,320 - 153,473,554	RGD	NCBI36
Celera	X	153,980,133 - 153,980,367	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,330 - 142,365,564	UniSTS

ECD22079

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,826,136 - 153,826,366	UniSTS	GRCh37
Build 36	X	153,479,330 - 153,479,560	RGD	NCBI36
Celera	X	153,986,143 - 153,986,373	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,371,340 - 142,371,570	UniSTS

ECD23788

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,836,041 - 153,836,217	UniSTS	GRCh37
Build 36	X	153,489,235 - 153,489,411	RGD	NCBI36
Celera	X	153,996,045 - 153,996,221	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,244 - 142,381,420	UniSTS

ECD24456

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,846,714 - 153,846,837	UniSTS	GRCh37
GRCh37	X	153,814,103 - 153,814,226	UniSTS	GRCh37
Build 36	X	153,467,297 - 153,467,420	RGD	NCBI36
Celera	X	154,006,718 - 154,006,841	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,391,337 - 142,391,460	UniSTS

REN90033

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,819,890 - 153,820,125	UniSTS	GRCh37
Build 36	X	153,473,084 - 153,473,319	RGD	NCBI36
Celera	X	153,979,897 - 153,980,132	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,094 - 142,365,329	UniSTS

REN90034

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,081 - 153,820,325	UniSTS	GRCh37
Build 36	X	153,473,275 - 153,473,519	RGD	NCBI36
Celera	X	153,980,088 - 153,980,332	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,285 - 142,365,529	UniSTS

REN90035

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,244 - 153,820,501	UniSTS	GRCh37
Build 36	X	153,473,438 - 153,473,695	RGD	NCBI36
Celera	X	153,980,251 - 153,980,508	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,448 - 142,365,705	UniSTS

REN90036

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,341 - 153,820,589	UniSTS	GRCh37
Build 36	X	153,473,535 - 153,473,783	RGD	NCBI36
Celera	X	153,980,348 - 153,980,596	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,545 - 142,365,793	UniSTS

REN90037

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,566 - 153,820,814	UniSTS	GRCh37
Build 36	X	153,473,760 - 153,474,008	RGD	NCBI36
Celera	X	153,980,573 - 153,980,821	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,770 - 142,366,018	UniSTS

REN90038

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,786 - 153,821,050	UniSTS	GRCh37
Build 36	X	153,473,980 - 153,474,244	RGD	NCBI36
Celera	X	153,980,793 - 153,981,057	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,990 - 142,366,254	UniSTS

REN90039

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,027 - 153,821,280	UniSTS	GRCh37
Build 36	X	153,474,221 - 153,474,474	RGD	NCBI36
Celera	X	153,981,034 - 153,981,287	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,366,231 - 142,366,484	UniSTS

REN90040

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,260 - 153,821,498	UniSTS	GRCh37
Build 36	X	153,474,454 - 153,474,692	RGD	NCBI36
Celera	X	153,981,267 - 153,981,505	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,366,464 - 142,366,702	UniSTS

REN90041

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,490 - 153,821,749	UniSTS	GRCh37
Build 36	X	153,474,684 - 153,474,943	RGD	NCBI36
Celera	X	153,981,497 - 153,981,756	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,366,694 - 142,366,953	UniSTS

REN90042

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,730 - 153,821,971	UniSTS	GRCh37
Build 36	X	153,474,924 - 153,475,165	RGD	NCBI36
Celera	X	153,981,737 - 153,981,978	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,366,934 - 142,367,175	UniSTS

REN90043

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,947 - 153,822,197	UniSTS	GRCh37
Build 36	X	153,475,141 - 153,475,391	RGD	NCBI36
Celera	X	153,981,954 - 153,982,204	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,151 - 142,367,401	UniSTS

REN90044

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,822,141 - 153,822,405	UniSTS	GRCh37
Build 36	X	153,475,335 - 153,475,599	RGD	NCBI36
Celera	X	153,982,148 - 153,982,412	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,345 - 142,367,609	UniSTS

REN90045

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,822,397 - 153,822,655	UniSTS	GRCh37
Build 36	X	153,475,591 - 153,475,849	RGD	NCBI36
Celera	X	153,982,404 - 153,982,662	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,601 - 142,367,859	UniSTS

REN90046

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,822,632 - 153,822,867	UniSTS	GRCh37
Build 36	X	153,475,826 - 153,476,061	RGD	NCBI36
Celera	X	153,982,639 - 153,982,874	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,836 - 142,368,071	UniSTS

REN90047

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,822,844 - 153,823,099	UniSTS	GRCh37
Build 36	X	153,476,038 - 153,476,293	RGD	NCBI36
Celera	X	153,982,851 - 153,983,106	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,368,048 - 142,368,303	UniSTS

REN90048

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,823,075 - 153,823,338	UniSTS	GRCh37
Build 36	X	153,476,269 - 153,476,532	RGD	NCBI36
Celera	X	153,983,082 - 153,983,345	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,368,279 - 142,368,542	UniSTS

REN90049

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,823,337 - 153,823,587	UniSTS	GRCh37
Build 36	X	153,476,531 - 153,476,781	RGD	NCBI36
Celera	X	153,983,344 - 153,983,594	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,368,541 - 142,368,791	UniSTS

REN90050

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,823,568 - 153,823,817	UniSTS	GRCh37
Build 36	X	153,476,762 - 153,477,011	RGD	NCBI36
Celera	X	153,983,575 - 153,983,824	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,368,772 - 142,369,021	UniSTS

REN90051

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,823,730 - 153,823,971	UniSTS	GRCh37
Build 36	X	153,476,924 - 153,477,165	RGD	NCBI36
Celera	X	153,983,737 - 153,983,978	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,368,934 - 142,369,175	UniSTS

REN90052

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,823,981 - 153,824,189	UniSTS	GRCh37
GRCh37	X	153,823,936 - 153,824,189	UniSTS	GRCh37
Build 36	X	153,477,130 - 153,477,383	RGD	NCBI36
Celera	X	153,983,943 - 153,984,196	RGD
Celera	X	153,983,988 - 153,984,196	UniSTS
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,140 - 142,369,393	UniSTS
HuRef	X	142,369,185 - 142,369,393	UniSTS

REN90053

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,171 - 153,824,422	UniSTS	GRCh37
Build 36	X	153,477,365 - 153,477,616	RGD	NCBI36
Celera	X	153,984,178 - 153,984,429	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,375 - 142,369,626	UniSTS

REN90054

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,397 - 153,824,645	UniSTS	GRCh37
Build 36	X	153,477,591 - 153,477,839	RGD	NCBI36
Celera	X	153,984,404 - 153,984,652	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,601 - 142,369,849	UniSTS

REN90055

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,610 - 153,824,853	UniSTS	GRCh37
Build 36	X	153,477,804 - 153,478,047	RGD	NCBI36
Celera	X	153,984,617 - 153,984,860	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,814 - 142,370,057	UniSTS

REN90056

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,834 - 153,825,088	UniSTS	GRCh37
Build 36	X	153,478,028 - 153,478,282	RGD	NCBI36
Celera	X	153,984,841 - 153,985,095	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,370,038 - 142,370,292	UniSTS

REN90057

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,825,052 - 153,825,282	UniSTS	GRCh37
Build 36	X	153,478,246 - 153,478,476	RGD	NCBI36
Celera	X	153,985,059 - 153,985,289	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,370,256 - 142,370,486	UniSTS

REN90058

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,825,213 - 153,825,461	UniSTS	GRCh37
Build 36	X	153,478,407 - 153,478,655	RGD	NCBI36
Celera	X	153,985,220 - 153,985,468	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,370,417 - 142,370,665	UniSTS

REN90059

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,825,329 - 153,825,597	UniSTS	GRCh37
Build 36	X	153,478,523 - 153,478,791	RGD	NCBI36
Celera	X	153,985,336 - 153,985,604	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,370,533 - 142,370,801	UniSTS

REN90060

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,825,570 - 153,825,815	UniSTS	GRCh37
Build 36	X	153,478,764 - 153,479,009	RGD	NCBI36
Celera	X	153,985,577 - 153,985,822	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,370,774 - 142,371,019	UniSTS

REN90061

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,825,804 - 153,826,054	UniSTS	GRCh37
Build 36	X	153,478,998 - 153,479,248	RGD	NCBI36
Celera	X	153,985,811 - 153,986,061	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,371,008 - 142,371,258	UniSTS

REN90062

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,826,036 - 153,826,290	UniSTS	GRCh37
Build 36	X	153,479,230 - 153,479,484	RGD	NCBI36
Celera	X	153,986,043 - 153,986,297	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,371,240 - 142,371,494	UniSTS

REN90063

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,826,267 - 153,826,520	UniSTS	GRCh37
Build 36	X	153,479,461 - 153,479,714	RGD	NCBI36
Celera	X	153,986,274 - 153,986,527	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,371,471 - 142,371,724	UniSTS

REN90064

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,826,500 - 153,826,724	UniSTS	GRCh37
Build 36	X	153,479,694 - 153,479,918	RGD	NCBI36
Celera	X	153,986,507 - 153,986,731	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,371,704 - 142,371,928	UniSTS

REN90065

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,826,873 - 153,827,137	UniSTS	GRCh37
Build 36	X	153,480,067 - 153,480,331	RGD	NCBI36
Celera	X	153,986,880 - 153,987,143	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,372,077 - 142,372,340	UniSTS

REN90066

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,827,118 - 153,827,372	UniSTS	GRCh37
Build 36	X	153,480,312 - 153,480,566	RGD	NCBI36
Celera	X	153,987,124 - 153,987,378	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,372,321 - 142,372,575	UniSTS

REN90067

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,827,360 - 153,827,610	UniSTS	GRCh37
Build 36	X	153,480,554 - 153,480,804	RGD	NCBI36
Celera	X	153,987,366 - 153,987,616	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,372,563 - 142,372,813	UniSTS

REN90068

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,827,597 - 153,827,838	UniSTS	GRCh37
Build 36	X	153,480,791 - 153,481,032	RGD	NCBI36
Celera	X	153,987,603 - 153,987,844	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,372,800 - 142,373,041	UniSTS

REN90069

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,827,815 - 153,828,067	UniSTS	GRCh37
Build 36	X	153,481,009 - 153,481,261	RGD	NCBI36
Celera	X	153,987,821 - 153,988,073	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,018 - 142,373,270	UniSTS

REN90070

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,045 - 153,828,289	UniSTS	GRCh37
Build 36	X	153,481,239 - 153,481,483	RGD	NCBI36
Celera	X	153,988,051 - 153,988,295	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,248 - 142,373,492	UniSTS

REN90071

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,270 - 153,828,506	UniSTS	GRCh37
Build 36	X	153,481,464 - 153,481,700	RGD	NCBI36
Celera	X	153,988,276 - 153,988,512	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,473 - 142,373,709	UniSTS

REN90072

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,485 - 153,828,734	UniSTS	GRCh37
Build 36	X	153,481,679 - 153,481,928	RGD	NCBI36
Celera	X	153,988,491 - 153,988,740	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,688 - 142,373,937	UniSTS

REN90073

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,704 - 153,828,939	UniSTS	GRCh37
Build 36	X	153,481,898 - 153,482,133	RGD	NCBI36
Celera	X	153,988,710 - 153,988,945	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,907 - 142,374,142	UniSTS

REN90074

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,901 - 153,829,160	UniSTS	GRCh37
Build 36	X	153,482,095 - 153,482,354	RGD	NCBI36
Celera	X	153,988,907 - 153,989,164	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,104 - 142,374,363	UniSTS

REN90075

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,137 - 153,829,398	UniSTS	GRCh37
Build 36	X	153,482,331 - 153,482,592	RGD	NCBI36
Celera	X	153,989,141 - 153,989,402	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,340 - 142,374,601	UniSTS

REN90076

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,395 - 153,829,630	UniSTS	GRCh37
Build 36	X	153,482,589 - 153,482,824	RGD	NCBI36
Celera	X	153,989,399 - 153,989,634	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,598 - 142,374,833	UniSTS

REN90077

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,569 - 153,829,793	UniSTS	GRCh37
Build 36	X	153,482,763 - 153,482,987	RGD	NCBI36
Celera	X	153,989,573 - 153,989,797	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,772 - 142,374,996	UniSTS

REN90078

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,748 - 153,830,008	UniSTS	GRCh37
Build 36	X	153,482,942 - 153,483,202	RGD	NCBI36
Celera	X	153,989,752 - 153,990,012	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,374,951 - 142,375,211	UniSTS

REN90079

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,829,985 - 153,830,250	UniSTS	GRCh37
Build 36	X	153,483,179 - 153,483,444	RGD	NCBI36
Celera	X	153,989,989 - 153,990,254	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,375,188 - 142,375,453	UniSTS

REN90080

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,225 - 153,830,458	UniSTS	GRCh37
Build 36	X	153,483,419 - 153,483,652	RGD	NCBI36
Celera	X	153,990,229 - 153,990,462	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,375,428 - 142,375,661	UniSTS

REN90081

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,426 - 153,830,650	UniSTS	GRCh37
Build 36	X	153,483,620 - 153,483,844	RGD	NCBI36
Celera	X	153,990,430 - 153,990,654	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,375,629 - 142,375,853	UniSTS

REN90082

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,621 - 153,830,870	UniSTS	GRCh37
Build 36	X	153,483,815 - 153,484,064	RGD	NCBI36
Celera	X	153,990,625 - 153,990,874	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,375,824 - 142,376,073	UniSTS

REN90083

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,846 - 153,831,085	UniSTS	GRCh37
Build 36	X	153,484,040 - 153,484,279	RGD	NCBI36
Celera	X	153,990,850 - 153,991,089	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,049 - 142,376,288	UniSTS

REN90084

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,059 - 153,831,326	UniSTS	GRCh37
Build 36	X	153,484,253 - 153,484,520	RGD	NCBI36
Celera	X	153,991,063 - 153,991,330	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,262 - 142,376,529	UniSTS

REN90085

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,230 - 153,831,488	UniSTS	GRCh37
Build 36	X	153,484,424 - 153,484,682	RGD	NCBI36
Celera	X	153,991,234 - 153,991,492	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,433 - 142,376,691	UniSTS

REN90086

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,463 - 153,831,714	UniSTS	GRCh37
Build 36	X	153,484,657 - 153,484,908	RGD	NCBI36
Celera	X	153,991,467 - 153,991,718	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,666 - 142,376,917	UniSTS

REN90087

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,703 - 153,831,938	UniSTS	GRCh37
Build 36	X	153,484,897 - 153,485,132	RGD	NCBI36
Celera	X	153,991,707 - 153,991,942	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,906 - 142,377,141	UniSTS

REN90088

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,927 - 153,832,190	UniSTS	GRCh37
Build 36	X	153,485,121 - 153,485,384	RGD	NCBI36
Celera	X	153,991,931 - 153,992,194	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,130 - 142,377,393	UniSTS

REN90089

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,832,167 - 153,832,417	UniSTS	GRCh37
Build 36	X	153,485,361 - 153,485,611	RGD	NCBI36
Celera	X	153,992,171 - 153,992,421	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,370 - 142,377,620	UniSTS

REN90090

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,832,394 - 153,832,643	UniSTS	GRCh37
Build 36	X	153,485,588 - 153,485,837	RGD	NCBI36
Celera	X	153,992,398 - 153,992,647	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,597 - 142,377,846	UniSTS

REN90091

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,832,628 - 153,832,877	UniSTS	GRCh37
Build 36	X	153,485,822 - 153,486,071	RGD	NCBI36
Celera	X	153,992,632 - 153,992,881	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,831 - 142,378,080	UniSTS

REN90092

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,832,838 - 153,833,071	UniSTS	GRCh37
Build 36	X	153,486,032 - 153,486,265	RGD	NCBI36
Celera	X	153,992,842 - 153,993,075	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,378,041 - 142,378,274	UniSTS

REN90093

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,833,054 - 153,833,297	UniSTS	GRCh37
Build 36	X	153,486,248 - 153,486,491	RGD	NCBI36
Celera	X	153,993,058 - 153,993,301	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,378,257 - 142,378,500	UniSTS

REN90094

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,833,734 - 153,833,974	UniSTS	GRCh37
Build 36	X	153,486,928 - 153,487,168	RGD	NCBI36
Celera	X	153,993,738 - 153,993,978	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,378,937 - 142,379,177	UniSTS

REN90095

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,833,955 - 153,834,203	UniSTS	GRCh37
Build 36	X	153,487,149 - 153,487,397	RGD	NCBI36
Celera	X	153,993,959 - 153,994,207	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,379,158 - 142,379,406	UniSTS

REN90096

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,196 - 153,834,457	UniSTS	GRCh37
Build 36	X	153,487,390 - 153,487,651	RGD	NCBI36
Celera	X	153,994,200 - 153,994,461	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,379,399 - 142,379,660	UniSTS

REN90097

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,434 - 153,834,675	UniSTS	GRCh37
Build 36	X	153,487,628 - 153,487,869	RGD	NCBI36
Celera	X	153,994,438 - 153,994,679	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,379,637 - 142,379,878	UniSTS

REN90098

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,656 - 153,834,920	UniSTS	GRCh37
Build 36	X	153,487,850 - 153,488,114	RGD	NCBI36
Celera	X	153,994,660 - 153,994,924	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,379,859 - 142,380,123	UniSTS

REN90099

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,918 - 153,835,157	UniSTS	GRCh37
Build 36	X	153,488,112 - 153,488,351	RGD	NCBI36
Celera	X	153,994,922 - 153,995,161	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,121 - 142,380,360	UniSTS

REN90100

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,835,132 - 153,835,364	UniSTS	GRCh37
Build 36	X	153,488,326 - 153,488,558	RGD	NCBI36
Celera	X	153,995,136 - 153,995,368	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,335 - 142,380,567	UniSTS

REN90101

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,835,334 - 153,835,569	UniSTS	GRCh37
Build 36	X	153,488,528 - 153,488,763	RGD	NCBI36
Celera	X	153,995,338 - 153,995,573	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,537 - 142,380,772	UniSTS

REN90102

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,835,542 - 153,835,801	UniSTS	GRCh37
Build 36	X	153,488,736 - 153,488,995	RGD	NCBI36
Celera	X	153,995,546 - 153,995,805	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,745 - 142,381,004	UniSTS

REN90103

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,835,792 - 153,836,046	UniSTS	GRCh37
Build 36	X	153,488,986 - 153,489,240	RGD	NCBI36
Celera	X	153,995,796 - 153,996,050	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,995 - 142,381,249	UniSTS

REN90104

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,835,948 - 153,836,217	UniSTS	GRCh37
Build 36	X	153,489,142 - 153,489,411	RGD	NCBI36
Celera	X	153,995,952 - 153,996,221	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,151 - 142,381,420	UniSTS

REN90105

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,836,194 - 153,836,420	UniSTS	GRCh37
Build 36	X	153,489,388 - 153,489,614	RGD	NCBI36
Celera	X	153,996,198 - 153,996,424	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,397 - 142,381,624	UniSTS

REN90106

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,836,454 - 153,836,681	UniSTS	GRCh37
Build 36	X	153,489,648 - 153,489,875	RGD	NCBI36
Celera	X	153,996,458 - 153,996,685	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,658 - 142,381,885	UniSTS

REN90107

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,836,656 - 153,836,907	UniSTS	GRCh37
Build 36	X	153,489,850 - 153,490,101	RGD	NCBI36
Celera	X	153,996,660 - 153,996,911	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,860 - 142,382,111	UniSTS

REN90108

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,836,883 - 153,837,131	UniSTS	GRCh37
Build 36	X	153,490,077 - 153,490,325	RGD	NCBI36
Celera	X	153,996,887 - 153,997,135	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,382,087 - 142,382,335	UniSTS

REN90109

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,837,101 - 153,837,352	UniSTS	GRCh37
Build 36	X	153,490,295 - 153,490,546	RGD	NCBI36
Celera	X	153,997,105 - 153,997,356	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,382,305 - 142,382,556	UniSTS

REN90110

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,837,479 - 153,837,704	UniSTS	GRCh37
Build 36	X	153,490,673 - 153,490,898	RGD	NCBI36
Celera	X	153,997,483 - 153,997,708	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,382,683 - 142,382,908	UniSTS

REN90111

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,837,689 - 153,837,914	UniSTS	GRCh37
Build 36	X	153,490,883 - 153,491,108	RGD	NCBI36
Celera	X	153,997,693 - 153,997,918	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,382,893 - 142,383,118	UniSTS

REN90113

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,838,098 - 153,838,322	UniSTS	GRCh37
Build 36	X	153,491,292 - 153,491,516	RGD	NCBI36
Celera	X	153,998,102 - 153,998,326	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,383,302 - 142,383,526	UniSTS

REN90115

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,838,452 - 153,838,677	UniSTS	GRCh37
GRCh37	5	154,017,320 - 154,017,546	UniSTS	GRCh37
Build 36	X	153,491,646 - 153,491,871	RGD	NCBI36
Celera	X	153,998,456 - 153,998,681	RGD
Celera	5	150,094,366 - 150,094,592	UniSTS
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,383,656 - 142,383,881	UniSTS

REN90116

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,838,646 - 153,838,908	UniSTS	GRCh37
Build 36	X	153,491,840 - 153,492,102	RGD	NCBI36
Celera	X	153,998,650 - 153,998,912	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,383,850 - 142,384,112	UniSTS

REN90118

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,838,979 - 153,839,239	UniSTS	GRCh37
Build 36	X	153,492,173 - 153,492,433	RGD	NCBI36
Celera	X	153,998,983 - 153,999,243	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,384,183 - 142,384,443	UniSTS

REN90119

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,839,212 - 153,839,474	UniSTS	GRCh37
Build 36	X	153,492,406 - 153,492,668	RGD	NCBI36
Celera	X	153,999,216 - 153,999,478	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,384,416 - 142,384,678	UniSTS

REN90120

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	20,394,239 - 20,394,505	UniSTS	GRCh37
GRCh37	X	153,839,473 - 153,839,738	UniSTS	GRCh37
Build 36	X	153,492,667 - 153,492,932	RGD	NCBI36
Celera	19	20,300,362 - 20,300,628	UniSTS
Celera	X	153,999,477 - 153,999,742	RGD
Cytogenetic Map	19	p12	UniSTS
Cytogenetic Map	X	q28	UniSTS
HuRef	19	19,956,275 - 19,956,541	UniSTS
HuRef	X	142,384,677 - 142,384,942	UniSTS

REN90122

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,839,779 - 153,840,003	UniSTS	GRCh37
Build 36	X	153,492,973 - 153,493,197	RGD	NCBI36
Celera	X	153,999,783 - 154,000,007	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,384,983 - 142,385,207	UniSTS

REN90123

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,840,394 - 153,840,626	UniSTS	GRCh37
Build 36	X	153,493,588 - 153,493,820	RGD	NCBI36
Celera	X	154,000,398 - 154,000,630	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,385,598 - 142,385,830	UniSTS

REN90124

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,840,660 - 153,840,884	UniSTS	GRCh37
Build 36	X	153,493,854 - 153,494,078	RGD	NCBI36
Celera	X	154,000,664 - 154,000,888	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,385,864 - 142,386,088	UniSTS

stSG604162

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,848,111 - 153,849,329	UniSTS	GRCh37
GRCh37	X	153,811,611 - 153,812,829	UniSTS	GRCh37
Build 36	X	153,464,805 - 153,466,023	RGD	NCBI36
Celera	X	153,971,537 - 153,972,755	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,392,734 - 142,393,952	UniSTS

stSG604166

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,818,694 - 153,820,145	UniSTS	GRCh37
Build 36	X	153,471,888 - 153,473,339	RGD	NCBI36
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,363,898 - 142,365,349	UniSTS

stSG604167

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,820,126 - 153,821,219	UniSTS	GRCh37
Build 36	X	153,473,320 - 153,474,413	RGD	NCBI36
Celera	X	153,980,133 - 153,981,226	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,365,330 - 142,366,423	UniSTS

stSG604168

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,821,200 - 153,822,205	UniSTS	GRCh37
Build 36	X	153,474,394 - 153,475,399	RGD	NCBI36
Celera	X	153,981,207 - 153,982,212	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,366,404 - 142,367,409	UniSTS

stSG604169

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,822,195 - 153,823,216	UniSTS	GRCh37
Build 36	X	153,475,389 - 153,476,410	RGD	NCBI36
Celera	X	153,982,202 - 153,983,223	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,367,399 - 142,368,420	UniSTS

stSG604170

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,823,200 - 153,824,425	UniSTS	GRCh37
Build 36	X	153,476,394 - 153,477,619	RGD	NCBI36
Celera	X	153,983,207 - 153,984,432	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,368,404 - 142,369,629	UniSTS

stSG604171

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,824,406 - 153,825,406	UniSTS	GRCh37
Build 36	X	153,477,600 - 153,478,600	RGD	NCBI36
Celera	X	153,984,413 - 153,985,413	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,369,610 - 142,370,610	UniSTS

stSG604172

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,825,371 - 153,826,376	UniSTS	GRCh37
Build 36	X	153,478,565 - 153,479,570	RGD	NCBI36
Celera	X	153,985,378 - 153,986,383	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,370,575 - 142,371,580	UniSTS

stSG604173

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,826,354 - 153,827,610	UniSTS	GRCh37
Build 36	X	153,479,548 - 153,480,804	RGD	NCBI36
Celera	X	153,986,361 - 153,987,616	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,371,558 - 142,372,813	UniSTS

stSG604174

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,827,596 - 153,828,718	UniSTS	GRCh37
Build 36	X	153,480,790 - 153,481,912	RGD	NCBI36
Celera	X	153,987,602 - 153,988,724	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,372,799 - 142,373,921	UniSTS

stSG604175

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,828,700 - 153,829,893	UniSTS	GRCh37
Build 36	X	153,481,894 - 153,483,087	RGD	NCBI36
Celera	X	153,988,706 - 153,989,897	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,373,903 - 142,375,096	UniSTS

stSG604176

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,830,017 - 153,831,231	UniSTS	GRCh37
Build 36	X	153,483,211 - 153,484,425	RGD	NCBI36
Celera	X	153,990,021 - 153,991,235	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,375,220 - 142,376,434	UniSTS

stSG604177

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,831,218 - 153,832,228	UniSTS	GRCh37
Build 36	X	153,484,412 - 153,485,422	RGD	NCBI36
Celera	X	153,991,222 - 153,992,232	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,376,421 - 142,377,431	UniSTS

stSG604178

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,832,209 - 153,833,222	UniSTS	GRCh37
Build 36	X	153,485,403 - 153,486,416	RGD	NCBI36
Celera	X	153,992,213 - 153,993,226	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,377,412 - 142,378,425	UniSTS

stSG604180

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,834,224 - 153,835,257	UniSTS	GRCh37
Build 36	X	153,487,418 - 153,488,451	RGD	NCBI36
Celera	X	153,994,228 - 153,995,261	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,379,427 - 142,380,460	UniSTS

stSG604181

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,835,245 - 153,836,465	UniSTS	GRCh37
Build 36	X	153,488,439 - 153,489,659	RGD	NCBI36
Celera	X	153,995,249 - 153,996,469	RGD
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,380,448 - 142,381,669	UniSTS

stSG604182

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	X	153,878,705 - 153,878,931	UniSTS	GRCh37
GRCh37	X	153,836,446 - 153,836,672	UniSTS	GRCh37
Build 36	X	153,489,640 - 153,489,866	RGD	NCBI36
Celera	X	153,996,450 - 153,996,676	RGD
Celera	X	154,036,786 - 154,037,012	UniSTS
Cytogenetic Map	X	q28	UniSTS
HuRef	X	142,381,650 - 142,381,876	UniSTS
HuRef	X	142,423,328 - 142,423,554	UniSTS

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	668
Count of miRNA genes:	468
Interacting mature miRNAs:	504
Transcripts:	ENST00000328435, ENST00000359887
Prediction methods:	Microtar, Miranda, Pita, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

adipose tissue

appendage

High

Medium

Low

Below cutoff

1473

1784

504

515

2133

1096

1278

944

549

547

1565

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC244107	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF038567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF277315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ003149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ275977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ275978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC130362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC130364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U87459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENST00000328435 ⟹ ENSP00000332602

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	X	154,617,609 - 154,619,271 (-)	Ensembl

RefSeq Acc Id:

ENST00000359887 ⟹ ENSP00000352953

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	X	154,617,609 - 154,619,282 (-)	Ensembl

RefSeq Acc Id:

NM_001327 ⟹ NP_001318

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	154,617,609 - 154,619,282 (-)	NCBI
GRCh37	X	153,845,865 - 153,847,522 (-)	ENTREZGENE
Build 36	X	153,499,059 - 153,500,714 (-)	NCBI Archive
HuRef	X	142,391,018 - 142,392,145 (-)	ENTREZGENE
CHM1_1	X	153,757,593 - 153,759,255 (-)	NCBI

Sequence:

show sequence

ATCCTCGTGGGCCCTGACCTTCTCTCTGAGAGCCGGGCAGAGGCTCCGGAGCCATGCAGGCCGA
AGGCCGGGGCACAGGGGGTTCGACGGGCGATGCTGATGGCCCAGGAGGCCCTGGCATTCCTGAT
GGCCCAGGGGGCAATGCTGGCGGCCCAGGAGAGGCGGGTGCCACGGGCGGCAGAGGTCCCCGGG
GCGCAGGGGCAGCAAGGGCCTCGGGGCCGGGAGGAGGCGCCCCGCGGGGTCCGCATGGCGGCGC
GGCTTCAGGGCTGAATGGATGCTGCAGATGCGGGGCCAGGGGGCCGGAGAGCCGCCTGCTTGAG
TTCTACCTCGCCATGCCTTTCGCGACACCCATGGAAGCAGAGCTGGCCCGCAGGAGCCTGGCCC
AGGATGCCCCACCGCTTCCCGTGCCAGGGGTGCTTCTGAAGGAGTTCACTGTGTCCGGCAACAT
ACTGACTATCCGACTGACTGCTGCAGACCACCGCCAACTGCAGCTCTCCATCAGCTCCTGTCTC
CAGCAGCTTTCCCTGTTGATGTGGATCACGCAGTGCTTTCTGCCCGTGTTTTTGGCTCAGCCTC
CCTCAGGGCAGAGGCGCTAAGCCCAGCCTGGCGCCCCTTCCTAGGTCATGCCTCCTCCCCTAGG
GAATGGTCCCAGCACGAGTGGCCAGTTCATTGTGGGGGCCTGATTGTTTGTCGCTGGAGGAGGA
CGGCTTACATGTTTGTTTCTGTAGAAAATAAAACTGAGCTACGAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001318	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB49693	(Get FASTA)	NCBI Sequence Viewer
	AAD05202	(Get FASTA)	NCBI Sequence Viewer
	AAD05203	(Get FASTA)	NCBI Sequence Viewer
	AAI30363	(Get FASTA)	NCBI Sequence Viewer
	AAI30365	(Get FASTA)	NCBI Sequence Viewer
	AAL27014	(Get FASTA)	NCBI Sequence Viewer
	CAA05908	(Get FASTA)	NCBI Sequence Viewer
	CAB76943	(Get FASTA)	NCBI Sequence Viewer
	CAB76944	(Get FASTA)	NCBI Sequence Viewer
	CAB76945	(Get FASTA)	NCBI Sequence Viewer
	EAW72674	(Get FASTA)	NCBI Sequence Viewer
	P78358	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001318 ⟸ NM_001327
- UniProtKB:	P78358 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGP HGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTV SGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR hide sequence

RefSeq Acc Id:

ENSP00000352953 ⟸ ENST00000359887

RefSeq Acc Id:

ENSP00000332602 ⟸ ENST00000328435

Promoters

RGD ID:

13628656

Promoter ID:

EPDNEW_H29568

Type:

initiation region

Name:

CTAG1B_1

Description:

cancer/testis antigen 1B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	X	154,619,283 - 154,619,343	EPDNEW

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 Xp22.33-q28(chrX:3092486-155699618)x2	copy number gain	See cases [RCV000050889]	ChrX:3092486..155699618 [GRCh38] ChrX:3010527..154929279 [GRCh37] ChrX:3020527..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:150036146-156022206)x3	copy number gain	See cases [RCV000050946]	ChrX:150036146..156022206 [GRCh38] ChrX:149298619..155251871 [GRCh37] ChrX:148955035..154905065 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20140-155699618)x3	copy number gain	See cases [RCV000050810]	ChrX:20140..155699618 [GRCh38] ChrX:70140..154929279 [GRCh37] ChrX:10140..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20140-155699618)x1	copy number loss	See cases [RCV000050811]	ChrX:20140..155699618 [GRCh38] ChrX:70140..154929279 [GRCh37] ChrX:10140..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x1	copy number loss	See cases [RCV000050699]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000050385]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000050385]\|See cases [RCV000050385]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:149989929-156022206)x3	copy number gain	See cases [RCV000050657]	ChrX:149989929..156022206 [GRCh38] ChrX:149158160..155251871 [GRCh37] ChrX:148908818..154905065 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x1	copy number loss	Global developmental delay [RCV000050386]\|See cases [RCV000050386]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x3	copy number gain	See cases [RCV000050697]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xq23-28(chrX:115417992-156022206)x1	copy number loss	See cases [RCV000051160]	ChrX:115417992..156022206 [GRCh38] ChrX:114652461..155251871 [GRCh37] ChrX:114558717..154905065 [NCBI36] ChrX:Xq23-28	pathogenic
GRCh38/hg38 Xq27.3-28(chrX:145879711-156022206)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051747]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051747]\|See cases [RCV000051747]	ChrX:145879711..156022206 [GRCh38] ChrX:146715565..155251871 [GRCh37] ChrX:144768921..154905065 [NCBI36] ChrX:Xq27.3-28	pathogenic
GRCh38/hg38 Xp11.21-q28(chrX:57372584-155996431)x1	copy number loss	See cases [RCV000051665]	ChrX:57372584..155996431 [GRCh38] ChrX:57399017..155226096 [GRCh37] ChrX:57415742..154879290 [NCBI36] ChrX:Xp11.21-q28	pathogenic
GRCh38/hg38 Xq28(chrX:153296806-155699618)x1	copy number loss	See cases [RCV000051750]	ChrX:153296806..155699618 [GRCh38] ChrX:152568327..154929279 [GRCh37] ChrX:152215458..154582473 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq11.1-28(chrX:63279794-155939524)x1	copy number loss	See cases [RCV000051666]	ChrX:63279794..155939524 [GRCh38] ChrX:62499671..155169188 [GRCh37] ChrX:62416396..154822382 [NCBI36] ChrX:Xq11.1-28	pathogenic
GRCh38/hg38 Xq23-28(chrX:116264813-155980575)x1	copy number loss	See cases [RCV000051728]	ChrX:116264813..155980575 [GRCh38] ChrX:115396069..155210240 [GRCh37] ChrX:115310097..154863434 [NCBI36] ChrX:Xq23-28	pathogenic
GRCh38/hg38 Xq25-28(chrX:126537861-155996431)x1	copy number loss	See cases [RCV000051729]	ChrX:126537861..155996431 [GRCh38] ChrX:125671844..155226096 [GRCh37] ChrX:125499525..154879290 [NCBI36] ChrX:Xq25-28	pathogenic
GRCh38/hg38 Xq22.1-28(chrX:100524562-155669954)x1	copy number loss	See cases [RCV000051713]	ChrX:100524562..155669954 [GRCh38] ChrX:99779559..154785891 [GRCh37] ChrX:99666215..154552809 [NCBI36] ChrX:Xq22.1-28	pathogenic
GRCh38/hg38 Xq26.3-28(chrX:136956500-156020993)x1	copy number loss	See cases [RCV000051732]	ChrX:136956500..156020993 [GRCh38] ChrX:136038659..155250658 [GRCh37] ChrX:135866325..154903852 [NCBI36] ChrX:Xq26.3-28	pathogenic
GRCh38/hg38 Xq27.1-28(chrX:140445228-155998166)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051746]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000051746]\|See cases [RCV000051746]	ChrX:140445228..155998166 [GRCh38] ChrX:139527393..155227831 [GRCh37] ChrX:139355059..154881025 [NCBI36] ChrX:Xq27.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:237659-156022362)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052327]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052327]\|See cases [RCV000052327]	ChrX:237659..156022362 [GRCh38] ChrX:154326..155252027 [GRCh37] ChrX:94326..154905221 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:27245-155996431)x3	copy number gain	See cases [RCV000052324]	ChrX:27245..155996431 [GRCh38] ChrX:77245..155226096 [GRCh37] ChrX:17245..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2790845-155699618)x3	copy number gain	See cases [RCV000052359]	ChrX:2790845..155699618 [GRCh38] ChrX:2708886..154929279 [GRCh37] ChrX:2718886..154582473 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:40704-156022362)x3	copy number gain	See cases [RCV000052325]	ChrX:40704..156022362 [GRCh38] ChrX:90704..155252027 [GRCh37] ChrX:30704..154905221 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26101-155999293)x3	copy number gain	See cases [RCV000052322]	ChrX:26101..155999293 [GRCh38] ChrX:76101..155228958 [GRCh37] ChrX:16101..154882152 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:153932045-155611794)x3	copy number gain	See cases [RCV000052529]	ChrX:153932045..155611794 [GRCh38] ChrX:152850692..154494649 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq28(chrX:152932818-156022206)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052490]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052490]\|See cases [RCV000052490]	ChrX:152932818..156022206 [GRCh38] ChrX:152173071..155251871 [GRCh37] ChrX:151852018..154905065 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq28(chrX:153395425-155687381)x2	copy number gain	See cases [RCV000052491]	ChrX:153395425..155687381 [GRCh38] ChrX:152314077..154570236 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq25-28(chrX:123731372-155687381)x3	copy number gain	See cases [RCV000052445]	ChrX:123731372..155687381 [GRCh38] ChrX:122865222..154917042 [GRCh37] ChrX:122692903..154570236 [NCBI36] ChrX:Xq25-28	pathogenic
GRCh38/hg38 Xq27.1-28(chrX:140226495-155687381)x2	copy number gain	See cases [RCV000052471]	ChrX:140226495..155687381 [GRCh38] ChrX:139308651..154917042 [GRCh37] ChrX:139136317..154570236 [NCBI36] ChrX:Xq27.1-28	pathogenic
GRCh38/hg38 Xq27.1-28(chrX:141160282-155699618)x3	copy number gain	See cases [RCV000052475]	ChrX:141160282..155699618 [GRCh38] ChrX:140254480..154929279 [GRCh37] ChrX:140082146..154582473 [NCBI36] ChrX:Xq27.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x1	copy number loss	Global developmental delay [RCV000052986]\|Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052987]\|Intellectual functioning disability [RCV000052988]\|Global developmental delay [RCV000052989]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052987]\|See cases [RCV000052986]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:14245-155999293)x1	copy number loss	Hypoplastic left heart [RCV000052982]\|See cases [RCV000052982]	ChrX:14245..155999293 [GRCh38] ChrX:64245..155228958 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x3	copy number gain	Global developmental delay [RCV000052984]\|Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052985]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052985]\|See cases [RCV000052984]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:154336596-154642063)x2	copy number gain	See cases [RCV000054320]	ChrX:154336596..154642063 [GRCh38] ChrX:153564946..153870337 [GRCh37] ChrX:153218140..153523531 [NCBI36] ChrX:Xq28	uncertain significance
GRCh38/hg38 Xq28(chrX:154394598-154626056)x2	copy number gain	See cases [RCV000054322]	ChrX:154394598..154626056 [GRCh38] ChrX:153622940..153854307 [GRCh37] ChrX:153276134..153507501 [NCBI36] ChrX:Xq28	uncertain significance
GRCh37/hg19 Xq28(chrX:153576750-154563104)x1	copy number loss	See cases [RCV000663390]	ChrX:153576750..154563104 [GRCh37] ChrX:Xq28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022826)x4	copy number gain	See cases [RCV000133654]	ChrX:10679..156022826 [GRCh38] ChrX:60679..155252491 [GRCh37] ChrX:679..154905685 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003242)x3	copy number gain	See cases [RCV000133911]	ChrX:10701..156003242 [GRCh38] ChrX:60701..155232907 [GRCh37] ChrX:701..154886101 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|likely pathogenic\|conflicting data from submitters
GRCh38/hg38 Xq27.1-28(chrX:139333024-155978689)x1	copy number loss	See cases [RCV000133818]	ChrX:139333024..155978689 [GRCh38] ChrX:138415183..155208354 [GRCh37] ChrX:138242849..154861548 [NCBI36] ChrX:Xq27.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-155978689)x1	copy number loss	See cases [RCV000133792]	ChrX:10701..155978689 [GRCh38] ChrX:60701..155208354 [GRCh37] ChrX:701..154861548 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x3	copy number gain	See cases [RCV000050385]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:679..154896026 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156013167)x1	copy number loss	See cases [RCV000050386]	ChrX:10679..156013167 [GRCh38] ChrX:60679..155242832 [GRCh37] ChrX:679..154896026 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:14245-155999293)x1	copy number loss	See cases [RCV000052982]	ChrX:14245..155999293 [GRCh38] ChrX:64245..155228958 [GRCh37] ChrX:4245..154882152 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x1	copy number loss	See cases [RCV000052986]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:16102..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:26102-155996431)x3	copy number gain	See cases [RCV000052984]	ChrX:26102..155996431 [GRCh38] ChrX:76102..155226096 [GRCh37] ChrX:16102..154879290 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq27.3-28(chrX:144627217-155434735)x3	copy number gain	See cases [RCV000133725]	ChrX:144627217..155434735 [GRCh38] ChrX:146715565..154664396 [GRCh37] ChrX:143516380..154317590 [NCBI36] ChrX:Xq27.3-28	pathogenic
GRCh38/hg38 Xq21.1-28(chrX:85123740-156022206)x3	copy number gain	See cases [RCV000133744]	ChrX:85123740..156022206 [GRCh38] ChrX:84378746..155251871 [GRCh37] ChrX:84265402..154905065 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-155999253)x3	copy number gain	See cases [RCV000134564]	ChrX:20297..155999253 [GRCh38] ChrX:70297..155228918 [GRCh37] ChrX:10297..154882112 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq21.1-28(chrX:78605009-156016560)x1	copy number loss	See cases [RCV000134570]	ChrX:78605009..156016560 [GRCh38] ChrX:77860506..155246225 [GRCh37] ChrX:77747162..154899419 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003242)x1	copy number loss	See cases [RCV000133947]	ChrX:10701..156003242 [GRCh38] ChrX:60701..155232907 [GRCh37] ChrX:701..154886101 [NCBI36] ChrX:Xp22.33-q28	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 Xq11.1-28(chrX:62712230-155978888)x3	copy number gain	See cases [RCV000134025]	ChrX:62712230..155978888 [GRCh38] ChrX:61931700..155208553 [GRCh37] ChrX:61848425..154861747 [NCBI36] ChrX:Xq11.1-28	pathogenic
GRCh38/hg38 Xp21.1-q28(chrX:37076284-156016920)x1	copy number loss	See cases [RCV000135300]	ChrX:37076284..156016920 [GRCh38] ChrX:37094357..155246585 [GRCh37] ChrX:37004278..154899779 [NCBI36] ChrX:Xp21.1-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-156026127)x1	copy number loss	See cases [RCV000135321]	ChrX:20297..156026127 [GRCh38] ChrX:70297..155255792 [GRCh37] ChrX:10297..154908986 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq21.31-28(chrX:92222680-156016920)x1	copy number loss	See cases [RCV000135307]	ChrX:92222680..156016920 [GRCh38] ChrX:91477679..155246585 [GRCh37] ChrX:91364335..154899779 [NCBI36] ChrX:Xq21.31-28	pathogenic
GRCh38/hg38 Xq13.2-28(chrX:74510116-156022206)x1	copy number loss	See cases [RCV000134958]	ChrX:74510116..156022206 [GRCh38] ChrX:73729951..155251871 [GRCh37] ChrX:73646676..154905065 [NCBI36] ChrX:Xq13.2-28	pathogenic
GRCh38/hg38 Xq23-28(chrX:114533139-156022206)x1	copy number loss	See cases [RCV000134947]	ChrX:114533139..156022206 [GRCh38] ChrX:113767592..155251871 [GRCh37] ChrX:113673848..154905065 [NCBI36] ChrX:Xq23-28	pathogenic
GRCh38/hg38 Xp21.1-q28(chrX:36237706-156022206)x1	copy number loss	See cases [RCV000135552]	ChrX:36237706..156022206 [GRCh38] ChrX:36255823..155251871 [GRCh37] ChrX:36165744..154905065 [NCBI36] ChrX:Xp21.1-q28	pathogenic
GRCh38/hg38 Xq21.1-28(chrX:77369933-156013167)x1	copy number loss	See cases [RCV000135454]	ChrX:77369933..156013167 [GRCh38] ChrX:76634813..155242832 [GRCh37] ChrX:76507069..154896026 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:40904-155998166)x1	copy number loss	See cases [RCV000136478]	ChrX:40904..155998166 [GRCh38] ChrX:90904..155227831 [GRCh37] ChrX:30904..154881025 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq21.33-28(chrX:94462929-156001635)x3	copy number gain	See cases [RCV000136552]	ChrX:94462929..156001635 [GRCh38] ChrX:93717928..155231300 [GRCh37] ChrX:93604584..154884494 [NCBI36] ChrX:Xq21.33-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003229)x1	copy number loss	See cases [RCV000136097]	ChrX:10701..156003229 [GRCh38] ChrX:60701..155232894 [GRCh37] ChrX:701..154886088 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10001-156030895)x1	copy number loss	See cases [RCV000136005]	ChrX:10001..156030895 [GRCh38] ChrX:60001..155260560 [GRCh37] ChrX:1..154913754 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq25-28(chrX:128473235-156003229)x1	copy number loss	See cases [RCV000136095]	ChrX:128473235..156003229 [GRCh38] ChrX:127607213..155232894 [GRCh37] ChrX:127434894..154886088 [NCBI36] ChrX:Xq25-28	pathogenic
GRCh38/hg38 Xq27.1-28(chrX:140783390-155611114)x2	copy number gain	See cases [RCV000135881]	ChrX:140783390..155611114 [GRCh38] ChrX:139865555..154785891 [GRCh37] ChrX:139693221..154493969 [NCBI36] ChrX:Xq27.1-28	pathogenic
GRCh38/hg38 Xq21.1-28(chrX:79093152-156003229)x1	copy number loss	See cases [RCV000136083]	ChrX:79093152..156003229 [GRCh38] ChrX:78348649..155232894 [GRCh37] ChrX:78235305..154886088 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xq27.2-28(chrX:141650284-156022206)x1	copy number loss	See cases [RCV000136912]	ChrX:141650284..156022206 [GRCh38] ChrX:140738414..155251871 [GRCh37] ChrX:140566080..154905065 [NCBI36] ChrX:Xq27.2-28	pathogenic
GRCh38/hg38 Xq13.3-28(chrX:75086417-156022206)x1	copy number loss	See cases [RCV000137113]	ChrX:75086417..156022206 [GRCh38] ChrX:74306252..155251871 [GRCh37] ChrX:74222977..154905065 [NCBI36] ChrX:Xq13.3-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2782275-155611794)x2	copy number gain	See cases [RCV000136841]	ChrX:2782275..155611794 [GRCh38] ChrX:2700316..154785891 [GRCh37] ChrX:2710316..154494649 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:153322656-155522304)x2	copy number gain	See cases [RCV000136716]	ChrX:153322656..155522304 [GRCh38] ChrX:152864376..154751965 [GRCh37] ChrX:152241308..154405159 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq28(chrX:151750863-155522304)x1	copy number loss	See cases [RCV000136718]	ChrX:151750863..155522304 [GRCh38] ChrX:150919335..154751965 [GRCh37] ChrX:150669991..154405159 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2765636-155522304)x3	copy number gain	See cases [RCV000136791]	ChrX:2765636..155522304 [GRCh38] ChrX:2683677..154751965 [GRCh37] ChrX:2693677..154405159 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:153276277-156003242)x3	copy number gain	See cases [RCV000137498]	ChrX:153276277..156003242 [GRCh38] ChrX:152465185..155232907 [GRCh37] ChrX:152118379..154886101 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq11.1-28(chrX:62561604-156003242)x3	copy number gain	See cases [RCV000137553]	ChrX:62561604..156003242 [GRCh38] ChrX:61781074..155232907 [GRCh37] ChrX:61697799..154886101 [NCBI36] ChrX:Xq11.1-28	pathogenic
GRCh38/hg38 Xq22.1-28(chrX:102197284-156003242)x1	copy number loss	See cases [RCV000137415]	ChrX:102197284..156003242 [GRCh38] ChrX:101452257..155232907 [GRCh37] ChrX:101338913..154886101 [NCBI36] ChrX:Xq22.1-28	pathogenic
GRCh38/hg38 Xq26.3-28(chrX:137118983-156003242)x1	copy number loss	See cases [RCV000137257]	ChrX:137118983..156003242 [GRCh38] ChrX:136201142..155232907 [GRCh37] ChrX:136028808..154886101 [NCBI36] ChrX:Xq26.3-28	pathogenic\|uncertain significance
GRCh38/hg38 Xq25-28(chrX:123793526-156022206)x1	copy number loss	See cases [RCV000137167]	ChrX:123793526..156022206 [GRCh38] ChrX:122927376..155251871 [GRCh37] ChrX:122755057..154905065 [NCBI36] ChrX:Xq25-28	pathogenic\|uncertain significance
GRCh38/hg38 Xq28(chrX:154604412-154935279)x3	copy number gain	See cases [RCV000137292]	ChrX:154604412..154935279 [GRCh38] ChrX:153485859..153816748 [NCBI36] ChrX:Xq28	likely pathogenic
GRCh38/hg38 Xq13.3-28(chrX:76604011-156022206)x1	copy number loss	See cases [RCV000137138]	ChrX:76604011..156022206 [GRCh38] ChrX:75824420..155251871 [GRCh37] ChrX:75740824..154905065 [NCBI36] ChrX:Xq13.3-28	pathogenic
GRCh38/hg38 Xq21.33-28(chrX:95846285-156003242)x3	copy number gain	See cases [RCV000138020]	ChrX:95846285..156003242 [GRCh38] ChrX:95101284..155232907 [GRCh37] ChrX:94987940..154886101 [NCBI36] ChrX:Xq21.33-28	pathogenic
GRCh38/hg38 Xq22.3-28(chrX:106127173-156003242)x1	copy number loss	See cases [RCV000137887]	ChrX:106127173..156003242 [GRCh38] ChrX:105371166..155232907 [GRCh37] ChrX:105257822..154886101 [NCBI36] ChrX:Xq22.3-28	pathogenic
GRCh38/hg38 Xq27.3-28(chrX:143553831-156003229)x1	copy number loss	See cases [RCV000138679]	ChrX:143553831..156003229 [GRCh38] ChrX:142641674..155232894 [GRCh37] ChrX:142469340..154886088 [NCBI36] ChrX:Xq27.3-28	pathogenic
GRCh38/hg38 Xq21.1-28(chrX:79911061-156003229)x1	copy number loss	See cases [RCV000138787]	ChrX:79911061..156003229 [GRCh38] ChrX:79166568..155232894 [GRCh37] ChrX:79053224..154886088 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xq22.3-28(chrX:106465610-156003242)x1	copy number loss	See cases [RCV000138541]	ChrX:106465610..156003242 [GRCh38] ChrX:105708840..155232907 [GRCh37] ChrX:105595496..154886101 [NCBI36] ChrX:Xq22.3-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:1085618-155699644)x1	copy number loss	See cases [RCV000139278]	ChrX:1085618..155699644 [GRCh38] ChrX:1118268..154929305 [GRCh37] ChrX:1038268..154582499 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq21.31-28(chrX:88339926-156003242)x1	copy number loss	See cases [RCV000139351]	ChrX:88339926..156003242 [GRCh38] ChrX:87594927..155232907 [GRCh37] ChrX:87481583..154886101 [NCBI36] ChrX:Xq21.31-28	pathogenic\|likely benign
GRCh38/hg38 Xq21.1-28(chrX:82211310-156003229)x1	copy number loss	See cases [RCV000139400]	ChrX:82211310..156003229 [GRCh38] ChrX:81466759..155232894 [GRCh37] ChrX:81353415..154886088 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xq11.1-28(chrX:62712219-156003242)x3	copy number gain	See cases [RCV000139416]	ChrX:62712219..156003242 [GRCh38] ChrX:61931689..155232907 [GRCh37] ChrX:61848414..154886101 [NCBI36] ChrX:Xq11.1-28	pathogenic\|likely benign
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004181)x3	copy number gain	See cases [RCV000139888]	ChrX:251880..156004181 [GRCh38] ChrX:168547..155233846 [GRCh37] ChrX:108547..154887040 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq28(chrX:154559495-154736598)x2	copy number gain	See cases [RCV000140472]	ChrX:154559495..154736598 [GRCh38] ChrX:153787710..153964873 [GRCh37] ChrX:153440904..153618067 [NCBI36] ChrX:Xq28	benign
GRCh38/hg38 Xq28(chrX:154348522-154770053)x2	copy number gain	See cases [RCV000140492]	ChrX:154348522..154770053 [GRCh38] ChrX:153576890..153998328 [GRCh37] ChrX:153230084..153651522 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq27.1-28(chrX:139530928-156003229)x1	copy number loss	See cases [RCV000139724]	ChrX:139530928..156003229 [GRCh38] ChrX:138613087..155232894 [GRCh37] ChrX:138440753..154886088 [NCBI36] ChrX:Xq27.1-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:2299223-155992188)x3	copy number gain	See cases [RCV000141400]	ChrX:2299223..155992188 [GRCh38] ChrX:2217264..155221853 [GRCh37] ChrX:2227264..154875047 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:20297-156016920)x3	copy number gain	See cases [RCV000141401]	ChrX:20297..156016920 [GRCh38] ChrX:70297..155246585 [GRCh37] ChrX:10297..154899779 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x4	copy number gain	See cases [RCV000140786]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x1	copy number loss	See cases [RCV000140787]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic\|conflicting data from submitters
GRCh38/hg38 Xq21.1-28(chrX:82096719-156004066)x1	copy number loss	See cases [RCV000141825]	ChrX:82096719..156004066 [GRCh38] ChrX:81352168..155233731 [GRCh37] ChrX:81238824..154886925 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xq21.31-28(chrX:89557622-156004066)x1	copy number loss	See cases [RCV000142016]	ChrX:89557622..156004066 [GRCh38] ChrX:88812621..155233731 [GRCh37] ChrX:88699277..154886925 [NCBI36] ChrX:Xq21.31-28	pathogenic
GRCh38/hg38 Xq24-28(chrX:119297670-156004066)x1	copy number loss	See cases [RCV000141743]	ChrX:119297670..156004066 [GRCh38] ChrX:118431633..155233731 [GRCh37] ChrX:118315661..154886925 [NCBI36] ChrX:Xq24-28	pathogenic
GRCh38/hg38 Xq21.1-28(chrX:78187188-156004066)x1	copy number loss	See cases [RCV000142337]	ChrX:78187188..156004066 [GRCh38] ChrX:77442685..155233731 [GRCh37] ChrX:77329341..154886925 [NCBI36] ChrX:Xq21.1-28	pathogenic
GRCh38/hg38 Xq24-28(chrX:118856574-156004066)x1	copy number loss	See cases [RCV000142137]	ChrX:118856574..156004066 [GRCh38] ChrX:117990537..155233731 [GRCh37] ChrX:117874565..154886925 [NCBI36] ChrX:Xq24-28	pathogenic
GRCh38/hg38 Xq21.2-28(chrX:86626431-156004066)x1	copy number loss	See cases [RCV000142037]	ChrX:86626431..156004066 [GRCh38] ChrX:85881434..155233731 [GRCh37] ChrX:85768090..154886925 [NCBI36] ChrX:Xq21.2-28	pathogenic
GRCh38/hg38 Xq22.3-28(chrX:106722296-156004066)x1	copy number loss	See cases [RCV000142190]	ChrX:106722296..156004066 [GRCh38] ChrX:105965526..155233731 [GRCh37] ChrX:105852182..154886925 [NCBI36] ChrX:Xq22.3-28	pathogenic
GRCh38/hg38 Xq28(chrX:148951460-155434653)x2	copy number gain	See cases [RCV000143002]	ChrX:148951460..155434653 [GRCh38] ChrX:148956425..154664314 [GRCh37] ChrX:147840690..154317508 [NCBI36] ChrX:Xq28	pathogenic
GRCh38/hg38 Xq23-28(chrX:111050385-156022206)x1	copy number loss	See cases [RCV000142577]	ChrX:111050385..156022206 [GRCh38] ChrX:110293613..155251871 [GRCh37] ChrX:110180269..154905065 [NCBI36] ChrX:Xq23-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10701-156003229)x3	copy number gain	See cases [RCV000142625]	ChrX:10701..156003229 [GRCh38] ChrX:60701..155232894 [GRCh37] ChrX:701..154886088 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq13.2-28(chrX:74684615-156004066)x1	copy number loss	See cases [RCV000143424]	ChrX:74684615..156004066 [GRCh38] ChrX:73904450..155233731 [GRCh37] ChrX:73821175..154886925 [NCBI36] ChrX:Xq13.2-28	pathogenic
GRCh38/hg38 Xp11.22-q28(chrX:53144751-156003242)x1	copy number loss	See cases [RCV000143349]	ChrX:53144751..156003242 [GRCh38] ChrX:53321095..155232907 [GRCh37] ChrX:53190658..154886101 [NCBI36] ChrX:Xp11.22-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251879-156004066)x1	copy number loss	See cases [RCV000143441]	ChrX:251879..156004066 [GRCh38] ChrX:168546..155233731 [GRCh37] ChrX:108546..154886925 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251879-156004066)x3	copy number gain	See cases [RCV000143433]	ChrX:251879..156004066 [GRCh38] ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xq13.3-28(chrX:76557425-156004066)x1	copy number loss	See cases [RCV000143132]	ChrX:76557425..156004066 [GRCh38] ChrX:75777833..155233731 [GRCh37] ChrX:75694237..154886925 [NCBI36] ChrX:Xq13.3-28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:251880-156004066)x3	copy number gain	See cases [RCV000143219]	ChrX:251880..156004066 [GRCh38] ChrX:168547..155233731 [GRCh37] ChrX:108547..154886925 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x1	copy number loss	See cases [RCV000148135]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh38/hg38 Xp22.33-q28(chrX:10679-156022206)x3	copy number gain	See cases [RCV000148141]	ChrX:10679..156022206 [GRCh38] ChrX:60679..155251871 [GRCh37] ChrX:679..154905065 [NCBI36] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155246643)x3	copy number gain	See cases [RCV000240122]	ChrX:71267..155246643 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:62063537-155246643)x3	copy number gain	See cases [RCV000240143]	ChrX:62063537..155246643 [GRCh37] ChrX:Xq11.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:176426-155250222)x3	copy number gain	See cases [RCV000239843]	ChrX:176426..155250222 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155255839)x1	copy number loss	See cases [RCV000239832]	ChrX:71267..155255839 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.2-q28(chrX:13147668-155250222)x3	copy number gain	See cases [RCV000239798]	ChrX:13147668..155250222 [GRCh37] ChrX:Xp22.2-q28	pathogenic
GRCh37/hg19 Xq28(chrX:153627408-154089925)x2	copy number gain	See cases [RCV000240046]	ChrX:153627408..154089925 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155224766)x1	copy number loss	See cases [RCV000239902]	ChrX:71267..155224766 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60701-155246271)x3	copy number gain	See cases [RCV000239989]	ChrX:60701..155246271 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:150002-155234036)x2	copy number gain	See cases [RCV000240106]	ChrX:150002..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155234036)x2	copy number gain	See cases [RCV000239874]	ChrX:71267..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255839)x3	copy number gain	See cases [RCV000239934]	ChrX:70297..155255839 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:176426-155236656)x3	copy number gain	See cases [RCV000240552]	ChrX:176426..155236656 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:150002-155234036)x3	copy number gain	See cases [RCV000240314]	ChrX:150002..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:225816-155234036)x2	copy number gain	See cases [RCV000240464]	ChrX:225816..155234036 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq27.3-28(chrX:142174780-155250222)x2	copy number gain	See cases [RCV000240530]	ChrX:142174780..155250222 [GRCh37] ChrX:Xq27.3-28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:62063537-155250222)x3	copy number gain	See cases [RCV000240148]	ChrX:62063537..155250222 [GRCh37] ChrX:Xq11.1-28	pathogenic
GRCh37/hg19 Xq25-28(chrX:121022022-155211482)x1	copy number loss	See cases [RCV000240337]	ChrX:121022022..155211482 [GRCh37] ChrX:Xq25-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:2707626-155250222)x2	copy number gain	See cases [RCV000240541]	ChrX:2707626..155250222 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x3	copy number gain	See cases [RCV000449330]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255792)	copy number loss	See cases [RCV000449461]	ChrX:70297..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq21.33-28(chrX:94043221-155246585)x1	copy number loss	See cases [RCV000449365]	ChrX:94043221..155246585 [GRCh37] ChrX:Xq21.33-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-154930047)x3	copy number gain	See cases [RCV000449437]	ChrX:168546..154930047 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60701-155246225)x3	copy number gain	See cases [RCV000446270]	ChrX:60701..155246225 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.1-28(chrX:68701338-155233731)x3	copy number gain	See cases [RCV000446471]	ChrX:68701338..155233731 [GRCh37] ChrX:Xq13.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:2703632-155233731)x1	copy number loss	See cases [RCV000446712]	ChrX:2703632..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:71267-155255792)x1	copy number loss	See cases [RCV000446197]	ChrX:71267..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:318707-155224707)x1	copy number loss	See cases [RCV000446667]	ChrX:318707..155224707 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq28(chrX:152228560-154930047)x2	copy number gain	See cases [RCV000447331]	ChrX:152228560..154930047 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xq13.3-28(chrX:74787886-155233731)x1	copy number loss	See cases [RCV000447490]	ChrX:74787886..155233731 [GRCh37] ChrX:Xq13.3-28	pathogenic
GRCh37/hg19 Xp11.1-q28(chrX:58140271-155046703)x3	copy number gain	See cases [RCV000446151]	ChrX:58140271..155046703 [GRCh37] ChrX:Xp11.1-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x4	copy number gain	See cases [RCV000446932]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155196888)x3	copy number gain	See cases [RCV000446310]	ChrX:168546..155196888 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155081533)x3	copy number gain	See cases [RCV000447253]	ChrX:168546..155081533 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq28(chrX:150253008-155233731)x1	copy number loss	See cases [RCV000446761]	ChrX:150253008..155233731 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:553069-155233731)x1	copy number loss	See cases [RCV000446026]	ChrX:553069..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168566-155233731)x1	copy number loss	See cases [RCV000445720]	ChrX:168566..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq22.3-28(chrX:105694656-155224707)x1	copy number loss	See cases [RCV000445891]	ChrX:105694656..155224707 [GRCh37] ChrX:Xq22.3-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	See cases [RCV000448393]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq25-28(chrX:126773628-155233731)x1	copy number loss	See cases [RCV000448724]	ChrX:126773628..155233731 [GRCh37] ChrX:Xq25-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155255792)x4	copy number gain	See cases [RCV000448034]	ChrX:70297..155255792 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:70297-155246585)x1	copy number loss	See cases [RCV000448652]	ChrX:70297..155246585 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq26.3-28(chrX:134114063-155233731)x1	copy number loss	See cases [RCV000448865]	ChrX:134114063..155233731 [GRCh37] ChrX:Xq26.3-28	pathogenic
GRCh37/hg19 Xq28(chrX:151201777-154741703)x2	copy number gain	See cases [RCV000510478]	ChrX:151201777..154741703 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:55000501-155230750)x3	copy number gain	See cases [RCV000511787]	ChrX:55000501..155230750 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp21.2-q28(chrX:31088082-155233731)x1	copy number loss	See cases [RCV000511413]	ChrX:31088082..155233731 [GRCh37] ChrX:Xp21.2-q28	pathogenic
GRCh37/hg19 Xq23-28(chrX:112474054-155233731)x1	copy number loss	See cases [RCV000511572]	ChrX:112474054..155233731 [GRCh37] ChrX:Xq23-28	pathogenic
GRCh37/hg19 Xq24-28(chrX:116621104-155233731)x1	copy number loss	See cases [RCV000511936]	ChrX:116621104..155233731 [GRCh37] ChrX:Xq24-28	pathogenic
GRCh37/hg19 Xq21.1-28(chrX:79862302-155233731)x1	copy number loss	See cases [RCV000511482]	ChrX:79862302..155233731 [GRCh37] ChrX:Xq21.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168547-155233731)	copy number gain	See cases [RCV000512020]	ChrX:168547..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq21.31-28(chrX:86900388-155233731)x1	copy number loss	See cases [RCV000511490]	ChrX:86900388..155233731 [GRCh37] ChrX:Xq21.31-28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:56457791-155233731)x3	copy number gain	See cases [RCV000511307]	ChrX:56457791..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xq27.3-28(chrX:146232592-155233731)x1	copy number loss	See cases [RCV000511228]	ChrX:146232592..155233731 [GRCh37] ChrX:Xq27.3-28	pathogenic
GRCh37/hg19 Xq21.1-28(chrX:78230501-155233731)x1	copy number loss	See cases [RCV000510820]	ChrX:78230501..155233731 [GRCh37] ChrX:Xq21.1-28	pathogenic
GRCh37/hg19 Xq26.3-28(chrX:133944147-155233731)x3	copy number gain	See cases [RCV000511034]	ChrX:133944147..155233731 [GRCh37] ChrX:Xq26.3-28	pathogenic
GRCh37/hg19 Xq28(chrX:151963528-155233731)x1	copy number loss	See cases [RCV000510866]	ChrX:151963528..155233731 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xq28(chrX:151311551-155233731)x1	copy number loss	See cases [RCV000510920]	ChrX:151311551..155233731 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:57511767-155233731)x3	copy number gain	See cases [RCV000510826]	ChrX:57511767..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xq22.1-28(chrX:98495811-155233731)x1	copy number loss	See cases [RCV000512372]	ChrX:98495811..155233731 [GRCh37] ChrX:Xq22.1-28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:57415659-155233731)x3	copy number gain	See cases [RCV000512173]	ChrX:57415659..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xq25-28(chrX:125733292-155233846)x1	copy number loss	not provided [RCV000684386]	ChrX:125733292..155233846 [GRCh37] ChrX:Xq25-28	pathogenic
GRCh37/hg19 Xq27.1-28(chrX:138331745-155233731)x1	copy number loss	not provided [RCV000684397]	ChrX:138331745..155233731 [GRCh37] ChrX:Xq27.1-28	pathogenic
GRCh37/hg19 Xq27.1-28(chrX:139504488-155233731)x1	copy number loss	not provided [RCV000684401]	ChrX:139504488..155233731 [GRCh37] ChrX:Xq27.1-28	pathogenic
GRCh37/hg19 Xq27.2-28(chrX:140388077-155233731)x3	copy number gain	not provided [RCV000684402]	ChrX:140388077..155233731 [GRCh37] ChrX:Xq27.2-28	pathogenic
GRCh37/hg19 Xq28(chrX:153581543-153858492)x2	copy number gain	not provided [RCV000684413]	ChrX:153581543..153858492 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xq28(chrX:153621005-153868484)x4	copy number gain	not provided [RCV000684414]	ChrX:153621005..153868484 [GRCh37] ChrX:Xq28	uncertain significance
GRCh37/hg19 Xq22.3-28(chrX:107823442-155233731)x1	copy number loss	not provided [RCV000684373]	ChrX:107823442..155233731 [GRCh37] ChrX:Xq22.3-28	pathogenic
GRCh37/hg19 Xq21.31-28(chrX:91140025-155233731)x1	copy number loss	not provided [RCV000684357]	ChrX:91140025..155233731 [GRCh37] ChrX:Xq21.31-28	pathogenic
GRCh37/hg19 Xq22.1-28(chrX:99324651-155233731)x1	copy number loss	not provided [RCV000684363]	ChrX:99324651..155233731 [GRCh37] ChrX:Xq22.1-28	pathogenic
GRCh37/hg19 Xq28(chrX:153749360-155233731)x3	copy number gain	not provided [RCV000684416]	ChrX:153749360..155233731 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xq28(chrX:153560741-153858492)x2,3	copy number gain	not provided [RCV000684745]	ChrX:153560741..153858492 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp11.1-q28(chrX:58455352-155233731)x1	copy number loss	not provided [RCV000846274]	ChrX:58455352..155233731 [GRCh37] ChrX:Xp11.1-q28	pathogenic
GRCh37/hg19 Xq22.3-28(chrX:104098124-155233731)x1	copy number loss	not provided [RCV000846958]	ChrX:104098124..155233731 [GRCh37] ChrX:Xq22.3-28	pathogenic
GRCh37/hg19 Xq28(chrX:153827637-153888797)x2	copy number gain	not provided [RCV000753942]	ChrX:153827637..153888797 [GRCh37] ChrX:Xq28	benign
GRCh37/hg19 Xq27.1-28(chrX:138750575-155246749)x1	copy number loss	not provided [RCV000753810]	ChrX:138750575..155246749 [GRCh37] ChrX:Xq27.1-28	pathogenic
GRCh37/hg19 Xq27.1-28(chrX:139504958-155254881)x1	copy number loss	not provided [RCV000753815]	ChrX:139504958..155254881 [GRCh37] ChrX:Xq27.1-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60814-155254881)x2	copy number gain	not provided [RCV000753277]	ChrX:60814..155254881 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq13.2-28(chrX:73472626-155254881)x1	copy number loss	not provided [RCV000753606]	ChrX:73472626..155254881 [GRCh37] ChrX:Xq13.2-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60262-155245765)x1	copy number loss	not provided [RCV000753271]	ChrX:60262..155245765 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:181779-155171702)x1	copy number loss	not provided [RCV000753278]	ChrX:181779..155171702 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60814-155236712)x2	copy number gain	not provided [RCV000753276]	ChrX:60814..155236712 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:60262-155245765)x3	copy number gain	not provided [RCV000753272]	ChrX:60262..155245765 [GRCh37] ChrX:Xp22.33-q28	pathogenic
Single allele	duplication	Autistic disorder of childhood onset [RCV000754365]	ChrX:1..156040895 [GRCh38] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq11.1-28(chrX:61694576-155254881)x1	copy number loss	not provided [RCV000753556]	ChrX:61694576..155254881 [GRCh37] ChrX:Xq11.1-28	pathogenic
GRCh37/hg19 Xq25-28(chrX:122757437-155208244)x1	copy number loss	Premature ovarian insufficiency [RCV000852349]	ChrX:122757437..155208244 [GRCh37] ChrX:Xq25-28	likely pathogenic
GRCh37/hg19 Xq21.1-28(chrX:78444738-155233731)x1	copy number loss	not provided [RCV001007318]	ChrX:78444738..155233731 [GRCh37] ChrX:Xq21.1-28	pathogenic
GRCh37/hg19 Xq26.3-28(chrX:134975270-155233945)	copy number gain	not provided [RCV000767679]	ChrX:134975270..155233945 [GRCh37] ChrX:Xq26.3-28	pathogenic
GRCh37/hg19 Xq28(chrX:153761240-155227607)	copy number loss	not provided [RCV000767811]	ChrX:153761240..155227607 [GRCh37] ChrX:Xq28	likely pathogenic
GRCh37/hg19 Xq25-28(chrX:122924044-155233731)x1	copy number loss	not provided [RCV000849097]	ChrX:122924044..155233731 [GRCh37] ChrX:Xq25-28	pathogenic
NC_000023.10:g.(?_152954020)_(154096327_?)del	deletion	Adrenoleukodystrophy [RCV000815921]	ChrX:152954020..154096327 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x4	copy number gain	not provided [RCV000846039]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq28(chrX:153556428-153868487)x2	copy number gain	not provided [RCV000845970]	ChrX:153556428..153868487 [GRCh37] ChrX:Xq28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:54941868-155233731)x1	copy number loss	not provided [RCV000848218]	ChrX:54941868..155233731 [GRCh37] ChrX:Xp11.21-q28	uncertain significance
GRCh37/hg19 Xq21.32-28(chrX:92814516-155233731)x1	copy number loss	not provided [RCV000845672]	ChrX:92814516..155233731 [GRCh37] ChrX:Xq21.32-28	pathogenic
GRCh37/hg19 Xq24-28(chrX:118150047-155233731)x1	copy number loss	not provided [RCV000847838]	ChrX:118150047..155233731 [GRCh37] ChrX:Xq24-28	pathogenic
GRCh37/hg19 Xp22.33-q28(chrX:168546-155233731)x1	copy number loss	not provided [RCV000848828]	ChrX:168546..155233731 [GRCh37] ChrX:Xp22.33-q28	pathogenic
GRCh37/hg19 Xq21.1-28(chrX:84387417-155233731)x1	copy number loss	not provided [RCV001007322]	ChrX:84387417..155233731 [GRCh37] ChrX:Xq21.1-28	pathogenic
GRCh37/hg19 Xq25-28(chrX:122132166-155097214)	copy number loss	Intellectual disability [RCV001249592]	ChrX:122132166..155097214 [GRCh37] ChrX:Xq25-28	likely pathogenic
GRCh37/hg19 Xq21.33-28(chrX:94264404-155233731)x1	copy number loss	not provided [RCV001259012]	ChrX:94264404..155233731 [GRCh37] ChrX:Xq21.33-28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:55507789-155198481)x3	copy number gain	See cases [RCV001263024]	ChrX:55507789..155198481 [GRCh37] ChrX:Xp11.21-q28	pathogenic
GRCh37/hg19 Xp11.21-q28(chrX:56469080-155233731)x3	copy number gain	not provided [RCV001281359]	ChrX:56469080..155233731 [GRCh37] ChrX:Xp11.21-q28	pathogenic

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:2491	AgrOrtholog
COSMIC	CTAG1B	COSMIC
Ensembl Genes	ENSG00000184033	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000268651	UniProtKB/Swiss-Prot
Ensembl Protein	ENSP00000332602	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSP00000352953	UniProtKB/Swiss-Prot
	ENSP00000469441	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000328435	ENTREZGENE, UniProtKB/Swiss-Prot
	ENST00000359887	UniProtKB/Swiss-Prot
	ENST00000599837	UniProtKB/Swiss-Prot
GTEx	ENSG00000184033	GTEx
	ENSG00000268651	GTEx
HGNC ID	HGNC:2491	ENTREZGENE
Human Proteome Map	CTAG1B	Human Proteome Map
InterPro	CTAG/Pcc1	UniProtKB/Swiss-Prot
KEGG Report	hsa:1485	UniProtKB/Swiss-Prot
	hsa:246100	UniProtKB/Swiss-Prot
NCBI Gene	1485	ENTREZGENE
OMIM	300156	OMIM
PANTHER	PTHR31283	UniProtKB/Swiss-Prot
Pfam	Pcc1	UniProtKB/Swiss-Prot
PharmGKB	PA26993	PharmGKB
UniProt	CTG1B_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A1L417	UniProtKB/Swiss-Prot
	B7WNL9	UniProtKB/Swiss-Prot
	Q7LBY4	UniProtKB/Swiss-Prot
	Q9NY13	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar