OR6C70 (olfactory receptor family 6 subfamily C member 70)

Gene: OR6C70 (olfactory receptor family 6 subfamily C member 70) Homo sapiens

Analyze

Symbol:

OR6C70

Name:

olfactory receptor family 6 subfamily C member 70

RGD ID:

1346205

HGNC Page

HGNC:31299

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

olfactory receptor 6C70; olfactory receptor, family 6, subfamily C, member 70

RGD Orthologs

Alliance Genes

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	55,469,200 - 55,470,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	55,469,200 - 55,470,138 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	55,862,984 - 55,863,922 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	54,149,251 - 54,150,189 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	54,149,250 - 54,150,189	NCBI
Celera	12	55,515,181 - 55,516,119 (-)	NCBI		Celera
Cytogenetic Map	12	q13.2	NCBI
HuRef	12	52,901,748 - 52,902,686 (-)	NCBI		HuRef
CHM1_1	12	55,829,771 - 55,830,709 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	55,435,752 - 55,436,690 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3',4,4',5-Pentachlorobiphenyl (ISO)

bisphenol A (ISO)

cadmium dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IBA,IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:21873635	PMID:24152035	PMID:26186194	PMID:28514442

Genomics

Comparative Map Data

OR6C70
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	55,469,200 - 55,470,138 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	55,469,200 - 55,470,138 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	55,862,984 - 55,863,922 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	54,149,251 - 54,150,189 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	54,149,250 - 54,150,189	NCBI
Celera	12	55,515,181 - 55,516,119 (-)	NCBI		Celera
Cytogenetic Map	12	q13.2	NCBI
HuRef	12	52,901,748 - 52,902,686 (-)	NCBI		HuRef
CHM1_1	12	55,829,771 - 55,830,709 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	55,435,752 - 55,436,690 (-)	NCBI		T2T-CHM13v2.0

Or6c70
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	129,709,692 - 129,710,624 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	129,707,342 - 129,715,720 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	129,873,823 - 129,874,755 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	129,871,473 - 129,879,851 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	129,310,879 - 129,311,811 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	129,276,772 - 129,277,704 (-)	NCBI		MGSCv36	mm8
Celera	10	132,259,472 - 132,260,404 (-)	NCBI		Celera
Cytogenetic Map	10	D3	NCBI
cM Map	10	77.58	NCBI

Olr1057
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	7,125,807 - 7,126,745 (-)	NCBI		GRCr8
mRatBN7.2	7	6,474,994 - 6,475,932 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	3,102,570 - 3,103,508 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	9,366,702 - 9,367,640 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	11,242,363 - 11,243,301 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	9,050,574 - 9,051,512 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	16,404,763 - 16,405,701 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	16,404,755 - 16,405,751 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	16,571,902 - 16,572,840 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	7,912,859 - 7,913,797 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	7,912,858 - 7,913,797 (-)	NCBI
Celera	7	4,699,018 - 4,699,956 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

OR6C69
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	68,503 - 69,441 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	68,503 - 69,441 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	46,210,888 - 46,211,826 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	73,593 - 74,531 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	73,593 - 74,531 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	67,839 - 68,773 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	69,468 - 70,406 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	46,592,146 - 46,593,084 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101971896
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	59,640,773 - 59,641,714 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004937074	119,519 - 120,451 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004937074	119,506 - 120,467 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100513710
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	X	142,540,005 - 142,540,904 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103238470
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	51,459,901 - 51,461,782 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	194,546,124 - 194,547,180 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in OR6C70
20 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_001005499.1(OR6C70):c.453C>T (p.Phe151=)	single nucleotide variant	Malignant melanoma [RCV000062555]	Chr12:55469686 [GRCh38] Chr12:55863470 [GRCh37] Chr12:54149737 [NCBI36] Chr12:12q13.2	not provided
GRCh38/hg38 12p13.33-q24.33(chr12:121271-133196807)x3	copy number gain	See cases [RCV000139555]	Chr12:121271..133196807 [GRCh38] Chr12:282465..133773393 [GRCh37] Chr12:100698..132283466 [NCBI36] Chr12:12p13.33-q24.33	pathogenic
GRCh38/hg38 12q13.13-13.3(chr12:53420606-56202942)x3	copy number gain	See cases [RCV000141435]	Chr12:53420606..56202942 [GRCh38] Chr12:53814390..56596726 [GRCh37] Chr12:52100657..54882993 [NCBI36] Chr12:12q13.13-13.3	pathogenic
NM_001005519.2(OR6C68):c.667A>T (p.Ile223Phe)	single nucleotide variant	Malignant melanoma [RCV000062556]	Chr12:55493044 [GRCh38] Chr12:55886828 [GRCh37] Chr12:54173095 [NCBI36] Chr12:12q13.2	not provided
NM_001005494.1(OR6C4):c.112C>T (p.Leu38=)	single nucleotide variant	Malignant melanoma [RCV000070100]	Chr12:55551338 [GRCh38] Chr12:55945122 [GRCh37] Chr12:54231389 [NCBI36] Chr12:12q13.2	not provided
NM_206899.1(OR10P1):c.73G>A (p.Gly25Ser)	single nucleotide variant	Malignant melanoma [RCV000070101]	Chr12:55636964 [GRCh38] Chr12:56030748 [GRCh37] Chr12:54317015 [NCBI36] Chr12:12q13.2	not provided
NM_206899.1(OR10P1):c.901G>A (p.Ala301Thr)	single nucleotide variant	Malignant melanoma [RCV000070102]	Chr12:55637792 [GRCh38] Chr12:56031576 [GRCh37] Chr12:54317843 [NCBI36] Chr12:12q13.2	not provided
NC_000012.12:g.55480386G>T	single nucleotide variant	Lung cancer [RCV000111122]	Chr12:55480386 [GRCh38] Chr12:55874170 [GRCh37] Chr12:12q13.2	uncertain significance
NC_000012.12:g.55519536C>A	single nucleotide variant	Lung cancer [RCV000111123]	Chr12:55519536 [GRCh38] Chr12:55913320 [GRCh37] Chr12:12q13.2	uncertain significance
NM_206899.1(OR10P1):c.-1616T>C	single nucleotide variant	Lung cancer [RCV000111124]	Chr12:55635276 [GRCh38] Chr12:56029060 [GRCh37] Chr12:12q13.2	uncertain significance
GRCh37/hg19 12p13.33-q24.33(chr12:1-133851895)x3	copy number gain	See cases [RCV000258805]	Chr12:1..133851895 [GRCh37] Chr12:12p13.33-q24.33	pathogenic\|likely pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:173787-133777902)x3	copy number gain	See cases [RCV000510482]	Chr12:173787..133777902 [GRCh37] Chr12:12p13.33-q24.33	pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:173787-133777902)	copy number gain	See cases [RCV000511643]	Chr12:173787..133777902 [GRCh37] Chr12:12p13.33-q24.33	pathogenic
NM_001005499.1(OR6C70):c.704C>A (p.Ala235Asp)	single nucleotide variant	Inborn genetic diseases [RCV003274589]	Chr12:55469435 [GRCh38] Chr12:55863219 [GRCh37] Chr12:12q13.2	uncertain significance
GRCh37/hg19 12p13.33-q24.33(chr12:191619-133777645)x3	copy number gain	not provided [RCV000750246]	Chr12:191619..133777645 [GRCh37] Chr12:12p13.33-q24.33	pathogenic
GRCh37/hg19 12p13.33-q24.33(chr12:621220-133779118)x3	copy number gain	not provided [RCV000750253]	Chr12:621220..133779118 [GRCh37] Chr12:12p13.33-q24.33	pathogenic
GRCh37/hg19 12q13.2-14.1(chr12:55552371-62126304)x3	copy number gain	not provided [RCV001006505]	Chr12:55552371..62126304 [GRCh37] Chr12:12q13.2-14.1	pathogenic
NM_001005499.1(OR6C70):c.47C>T (p.Thr16Met)	single nucleotide variant	Inborn genetic diseases [RCV003297970]	Chr12:55470092 [GRCh38] Chr12:55863876 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.242T>A (p.Ile81Asn)	single nucleotide variant	Inborn genetic diseases [RCV002946316]	Chr12:55469897 [GRCh38] Chr12:55863681 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.130A>G (p.Ile44Val)	single nucleotide variant	Inborn genetic diseases [RCV002779499]	Chr12:55470009 [GRCh38] Chr12:55863793 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.23T>C (p.Ile8Thr)	single nucleotide variant	Inborn genetic diseases [RCV002784512]	Chr12:55470116 [GRCh38] Chr12:55863900 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.307A>G (p.Ile103Val)	single nucleotide variant	Inborn genetic diseases [RCV002978205]	Chr12:55469832 [GRCh38] Chr12:55863616 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.772A>C (p.Ile258Leu)	single nucleotide variant	Inborn genetic diseases [RCV002664732]	Chr12:55469367 [GRCh38] Chr12:55863151 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.38T>G (p.Leu13Arg)	single nucleotide variant	Inborn genetic diseases [RCV002930163]	Chr12:55470101 [GRCh38] Chr12:55863885 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.535A>C (p.Ile179Leu)	single nucleotide variant	Inborn genetic diseases [RCV002964622]	Chr12:55469604 [GRCh38] Chr12:55863388 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.385C>T (p.Arg129Cys)	single nucleotide variant	Inborn genetic diseases [RCV002960629]	Chr12:55469754 [GRCh38] Chr12:55863538 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.98G>C (p.Cys33Ser)	single nucleotide variant	Inborn genetic diseases [RCV002812881]	Chr12:55470041 [GRCh38] Chr12:55863825 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.893C>G (p.Ala298Gly)	single nucleotide variant	Inborn genetic diseases [RCV003174680]	Chr12:55469246 [GRCh38] Chr12:55863030 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.487A>G (p.Asn163Asp)	single nucleotide variant	Inborn genetic diseases [RCV003214649]	Chr12:55469652 [GRCh38] Chr12:55863436 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.248T>C (p.Ile83Thr)	single nucleotide variant	Inborn genetic diseases [RCV003208794]	Chr12:55469891 [GRCh38] Chr12:55863675 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.593T>A (p.Phe198Tyr)	single nucleotide variant	Inborn genetic diseases [RCV003363188]	Chr12:55469546 [GRCh38] Chr12:55863330 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.220G>T (p.Ala74Ser)	single nucleotide variant	Inborn genetic diseases [RCV003374600]	Chr12:55469919 [GRCh38] Chr12:55863703 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.297G>T (p.Leu99Phe)	single nucleotide variant	Inborn genetic diseases [RCV003383472]	Chr12:55469842 [GRCh38] Chr12:55863626 [GRCh37] Chr12:12q13.2	uncertain significance
NM_001005499.1(OR6C70):c.463T>G (p.Phe155Val)	single nucleotide variant	Inborn genetic diseases [RCV003355153]	Chr12:55469676 [GRCh38] Chr12:55863460 [GRCh37] Chr12:12q13.2	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENST00000327335
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	adipose tissue	appendage
High
Medium													1
Low			4	4	2	4	9	2	1	1	2	21	1		1
Below cutoff	166	446	93	54	95	7	356	239	201	18	242	109	47	75	242

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001005499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC009779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC122685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471054	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068266	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KP290456	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENST00000327335 ⟹ ENSP00000329153

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	12	55,469,200 - 55,470,138 (-)	Ensembl

RefSeq Acc Id:

NM_001005499 ⟹ NP_001005499

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	12	55,469,200 - 55,470,138 (-)	NCBI
GRCh37	12	55,862,984 - 55,863,922 (-)	RGD
Build 36	12	54,149,251 - 54,150,189 (-)	NCBI Archive
Celera	12	55,515,181 - 55,516,119 (-)	RGD
HuRef	12	52,901,748 - 52,902,686 (-)	RGD
CHM1_1	12	55,829,771 - 55,830,709 (-)	NCBI
T2T-CHM13v2.0	12	55,435,752 - 55,436,690 (-)	NCBI

Sequence:

show sequence

ATGAAGAATCATACAAGGCAGATAGAATTTATTCTTCTGGGACTGACGGATAATTCTCAGTTAC
AGATTGTAATTTTCTTATTTCTACTTCTAAATTGTGTGTTGAGCATGATAGGGAACTTCACTAT
CATTGCCCTCATTCTGCTGGATTCCCAGCTCAAGACTCCAATGTATTTCTTCCTCCGTAATTTC
TCTTTTCTGGAAATTTCATTCACAACTGCTTGCATTCCCAGATTCCTAATCACCATTGTTACCA
GGGAAAAGACCATTTCCTGTAATGGTTGCATATCTCAGTTGTTTTTTTACATATTCTTGGGGGT
TACAGAATTTTTCCTTCTAGCTGCTCTGTCCTATGATCGCTATGTTGCCATCTGCAAACCTTTG
CGTTATATGTCCATCATGAGTAACAAAGTTTGCTACCAGCTTGTATTCAGTTCTTGGGTAACTG
GATTCCTGATCATTTTCACTCCACTGATTTTAGGTCTTAACTTGGATTTCTGTGCTTCAAATAT
CATTGATCATTTCATTTGTGACATTTCTCTTATCCTACAACTTTCTTGCTCAGACACACATTTA
CTGGAACTGATTGCCTTTTTATTAGCTGTGATGACACTTATTGTCACATTGTTTTTAGTAATCC
TTTCTTACTCTTACATCATCAAGACAATTCTGAAATTCCCTTCAGCTCAGCAAAAGAAGAAAGC
CTTTTCCACCTGCTCTTCTCACATGATTGTTGTCTCCATCACTTATGGTAGTTGTATGTTTATC
TACATAAAGCCATCAGCGAATGAAAGAGTTGCTTTAAGCAAAGGAGTAACTGTGCTCAATACTT
CAGTTGCCCCGTTGTTAAACCCATTTATTTATACTCTGAGGAATCAGCAAGTTAAACAAGCCTT
CAAAGCTGTATTTAGAAAGATATTTTCTGCTTCAGACAAGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001005499	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A6NIJ9	(Get FASTA)	NCBI Sequence Viewer
	ALI87620	(Get FASTA)	NCBI Sequence Viewer
	EAW96813	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000329153
	ENSP00000329153.4

RefSeq Acc Id:

NP_001005499 ⟸ NM_001005499

- UniProtKB:

A6NIJ9 (UniProtKB/Swiss-Prot), A0A126GW26 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKNHTRQIEFILLGLTDNSQLQIVIFLFLLLNCVLSMIGNFTIIALILLDSQLKTPMYFFLRNF
SFLEISFTTACIPRFLITIVTREKTISCNGCISQLFFYIFLGVTEFFLLAALSYDRYVAICKPL
RYMSIMSNKVCYQLVFSSWVTGFLIIFTPLILGLNLDFCASNIIDHFICDISLILQLSCSDTHL
LELIAFLLAVMTLIVTLFLVILSYSYIIKTILKFPSAQQKKKAFSTCSSHMIVVSITYGSCMFI
YIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFKAVFRKIFSASDK

hide sequence

RefSeq Acc Id:

ENSP00000329153 ⟸ ENST00000327335

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A6NIJ9-F1-model_v2	AlphaFold	A6NIJ9	1-312	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:31299	AgrOrtholog
COSMIC	OR6C70	COSMIC
Ensembl Genes	ENSG00000184954	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000327335	ENTREZGENE
	ENST00000327335.4	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000184954	GTEx
HGNC ID	HGNC:31299	ENTREZGENE
Human Proteome Map	OR6C70	Human Proteome Map
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Olfact_rcpt_6C-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:390327	UniProtKB/Swiss-Prot
NCBI Gene	390327	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORY RECEPTOR 6C70	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA134915898	PharmGKB
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A126GW26	ENTREZGENE, UniProtKB/TrEMBL
	A6NIJ9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-15	OR6C70	olfactory receptor family 6 subfamily C member 70	OR6C70	olfactory receptor, family 6, subfamily C, member 70	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar