Gkn2 (gastrokine 2) - Rat Genome Database

Name: Gkn2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Gkn2 (gastrokine 2) Mus musculus

Analyze

Symbol:

Gkn2

Name:

gastrokine 2

RGD ID:

1332561

MGI Page

MGI

Description:

Is expressed in reproductive system; stomach; trunk; and yolk sac. Orthologous to human GKN2 (gastrokine 2); INTERACTS WITH 4,4'-sulfonyldiphenol; all-trans-retinoic acid; benzo[a]pyrene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Also known as:

1810036H07Rik; blottin; Bricd; Bricd1b; gastrokine-2

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GKN2 (gastrokine 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Gkn2 (gastrokine 2)	HGNC	Treefam, EggNOG, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Gkn2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GKN2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GKN2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gkn2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GKN2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	GKN2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gkn2 (gastrokine 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Gkn2 (gastrokine 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	GKN2 (gastrokine 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	87,350,347 - 87,356,476 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	87,350,339 - 87,356,479 (+)	Ensembl
GRCm38	6	87,373,365 - 87,379,494 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	87,373,357 - 87,379,497 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	87,323,359 - 87,329,488 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	87,338,999 - 87,345,128 (+)	NCBI			mm8
Celera	6	89,312,408 - 89,318,547 (+)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

4,4'-sulfonyldiphenol (EXP)

6-propyl-2-thiouracil (ISO)

all-trans-retinoic acid (EXP)

benzo[a]pyrene (EXP)

Benzo[k]fluoranthene (EXP)

bisphenol A (EXP,ISO)

butanal (ISO)

diuron (ISO)

folic acid (EXP)

glyphosate (ISO)

indole-3-methanol (ISO)

iron atom (ISO)

iron(0) (ISO)

N-acetyl-L-cysteine (ISO)

N-nitrosodiethylamine (ISO)

pentanal (ISO)

propanal (ISO)

silicon dioxide (ISO)

sodium dichromate (ISO)

tetraphene (EXP)

vinclozolin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of cell population proliferation (IBA)

response to bacterium (IEP)

Cellular Component

basal part of cell (IDA)

extracellular region (IEA)

extracellular space (IBA)

Golgi apparatus (IEA)

Molecular Function

molecular_function (ND)

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal cell differentiation (IAGP)

abnormal chemokine level (IAGP)

abnormal cytokine level (IAGP)

abnormal digestive system physiology (IAGP)

abnormal innate immunity (IAGP)

abnormal interleukin level (IAGP)

abnormal stomach mucosa morphology (IAGP)

abnormal susceptibility to bacterial infection (IAGP)

abnormal T-helper 1 physiology (IAGP)

abnormal tumor necrosis factor level (IAGP)

decreased myeloid cell number (IAGP)

decreased total body fat amount (IEA)

enlarged heart (IEA)

gastric gland atrophy (IAGP)

increased lean body mass (IEA)

increased stomach mucosa thickness (IAGP)

increased stomach tumor incidence (IAGP)

increased susceptibility to bacterial infection (IAGP)

stomach inflammation (IAGP)

References

References - curated


1.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGD and Homologene mouse data transfer
3.	MGD data from the GO Consortium
4.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
5.	RGD automated import pipeline
6.	RGD automated import pipeline for gene-chemical interactions
7.	Wheeler DL, etal., Nucleic Acids Res 2001 Jan 1;29(1):11-6.

Additional References at PubMed

PMID:10349636	PMID:11042159	PMID:11076861	PMID:12477932	PMID:15489334	PMID:16141072	PMID:16141073	PMID:16888721	PMID:20562862	PMID:21677750	PMID:21873635	PMID:23012479
PMID:24194600	PMID:25290738	PMID:26839965	PMID:26974160	PMID:27626380	PMID:28467908	PMID:31668390	PMID:32226647	PMID:32358519

Genomics

Comparative Map Data

Gkn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	87,350,347 - 87,356,476 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	87,350,339 - 87,356,479 (+)	Ensembl
GRCm38	6	87,373,365 - 87,379,494 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	87,373,357 - 87,379,497 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	87,323,359 - 87,329,488 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	87,338,999 - 87,345,128 (+)	NCBI			mm8
Celera	6	89,312,408 - 89,318,547 (+)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI

GKN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	2	68,945,232 - 68,952,893 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	2	68,945,232 - 68,952,893 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	2	69,172,364 - 69,180,025 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	69,025,868 - 69,033,606 (-)	NCBI	NCBI36		hg18	NCBI36
Celera	2	69,023,098 - 69,030,721 (-)	NCBI
Cytogenetic Map	2	p13.3	NCBI
HuRef	2	68,908,590 - 68,916,329 (-)	NCBI		HuRef
CHM1_1	2	69,101,686 - 69,109,425 (-)	NCBI		CHM1_1

Gkn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	119,778,326 - 119,824,366 (+)	NCBI
Rnor_6.0 Ensembl	4	119,171,245 - 119,177,329 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	4	119,131,255 - 119,177,329 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	4	183,699,839 - 183,746,373 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	121,524,326 - 121,530,410 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	4	121,766,678 - 121,774,891 (+)	NCBI
Celera	4	108,788,548 - 108,794,630 (+)	NCBI		Celera
Cytogenetic Map	4	q34	NCBI

Gkn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	16,071,246 - 16,078,008 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955424	16,071,246 - 16,078,008 (+)	NCBI	ChiLan1.0	ChiLan1.0

GKN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	70,108,200 - 70,115,918 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	70,107,973 - 70,115,918 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	68,986,424 - 68,994,148 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

GKN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	10	67,766,290 - 67,774,194 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	10	67,766,659 - 67,773,995 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Gkn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936491	13,233,729 - 13,238,305 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GKN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	73,443,846 - 73,452,046 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	73,443,856 - 73,451,789 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	76,885,074 - 76,893,021 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GKN2
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	38,171,433 - 38,179,689 (+)	NCBI
ChlSab1.1 Ensembl	14	38,172,306 - 38,179,457 (+)	Ensembl

Gkn2
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624762	4,420,481 - 4,432,701 (+)	NCBI

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	1	117500000	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139100000	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87426034	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96656149	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96656149	Mouse
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96656149	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96656149	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38669625	92607450	Mouse
1300618	Pgia19_m	proteoglycan induced arthritis 19 (mouse)			Not determined		6	45314059	87426034	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45314059	128835032	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46935985	136423692	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48720000	125360000	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48720000	148450000	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48726556	125356785	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52161713	116155267	Mouse
4141028	Mclr_m	methylcholanthrene lymphoma resistance (mouse)			Not determined			54373427	88379171	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56308211	90308211	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56308211	90308211	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58447583	92447710	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58540433	92540433	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60057680	94057799	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63484738	97484905	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66713869	100714031	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70425898	104426034	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70425898	104426034	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70425898	104426034	Mouse
1302020	Bbaa20_m	B.burgdorferi-associated arthritis 20 (mouse)			Not determined		6	71322621	93464093	Mouse
1300869	Stheal5_m	soft tissue heal 5 (mouse)			Not determined		6	71575060	105575178	Mouse
1300954	Fcsa1_m	femoral cross-sectional area 1 (mouse)			Not determined		6	71981024	105981170	Mouse
1301521	Pas1c_m	pulmonary adenoma susceptibility 1c (mouse)			Not determined		6	71981024	105981170	Mouse
13506930	Recrq9_m	recombination rate in male meiosis QTL 9 (mouse)					6	73500000	134700000	Mouse
1301320	Ots1_m	ovarian teratoma susceptibility 1 (mouse)			Not determined		6	75447583	104503555	Mouse
1301571	Arrd1_m	age-related retinal degeneration 1 (mouse)			Not determined		6	75544356	92607450	Mouse
1300674	Nidd3n_m	non-insulin-dependent diabetes mellitus 3 in NSY (mouse)			Not determined		6	75544356	94225955	Mouse
10412195	Efw_m	epididymal fat weight (mouse)			Not determined		6	75544356	94225955	Mouse
10043901	Pfat5_m	predicted fat percentage 5 (mouse)			Not determined		6	75607306	109607450	Mouse
10412208	Cypr4_m	cytokine production 4 (mouse)			Not determined		6	75716503	109716697	Mouse
1357875	Pfat2_m	predicted fat percentage 2 (mouse)			Not determined		6	76463949	110464093	Mouse
14697704	Stsl4_m	Salmonella typhimurium susceptibility locus 4 (mouse)					6	77100000	90000000	Mouse
13824985	Alh1_m	amplitude of lateral head displacement 1 (mouse)					6	78000000	97000000	Mouse
4141376	Dbm1_m	diabetes modifier 1 (mouse)			Not determined		6	78629504	121115387	Mouse
14696731	Pairq1_m	P. aeruginosa infection resistance QTL 1 (mouse)					6	81500000	102200000	Mouse
10043864	T2dm4sa_m	type 2 diabetes mellitus 4 in SMXA RI mice (mouse)			Not determined		6	83713869	147052561	Mouse
11251720	Ewc4_m	ethanol withdrawal and consumption 4 (mouse)					6	84122513	118122513	Mouse
1301687	Mnic2_m	macronutrient intake (mouse)			Not determined		6	86806805	113544602	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	68
Count of miRNA genes:	66
Interacting mature miRNAs:	66
Transcripts:	ENSMUST00000032128
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_025467	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC153853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK007451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK007705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY943909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000032128 ⟹ ENSMUSP00000032128

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	87,373,357 - 87,379,497 (+)	Ensembl

RefSeq Acc Id:

NM_025467 ⟹ NP_079743

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	87,350,347 - 87,356,476 (+)	NCBI
GRCm38	6	87,373,365 - 87,379,494 (+)	ENTREZGENE
MGSCv37	6	87,323,359 - 87,329,488 (+)	RGD
Celera	6	89,312,408 - 89,318,547 (+)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

ACACTGCTCCAGCAACTTCTCTTCAGGCAAAATGAAACCCCTCGTGGCATTTCTGGTGGTGCTG
TCCATCTTTGGAATACAATCGCAGGCAGAGGAGATTTTTAATATCTTCGTCCCAAGCAAAAATG
GAGGCAATATCCAGGAGACAGTGACCATCGACAACCAGCAGAACACGGCCACCATCAACATCCA
CTCAGGCTCGTGCTCCTCCACCACGATTTTTGACTATAAGCATGGTTACATCGCATCCCGGGTG
CTCTCCCGGAGAGCCTGTTACGTCATCAAGATGGACCACAAAGCCATCCCTGCTCTGGACAAAC
TCCAACGGTTCCTCTACGAGAAGCAGACAATGAATGCTATCGACTCCCCAGAGTATACCTGGGT
CAGGTACAACCCTCTGAAGTCTCTGATCACGAAGGTGGACTGGTTCCTGTTTGGGTCGCCTATT
CGACAGCTATGCAAGCACATGCCCCTGTATGAGGGTGAGGTGGCTACAAAGCCAAAAGAGGTGA
GCACTGGAGCCTGTGCAAAGGTTGGACTCCTGGGGATCCTGGGAGTCTCCATCTGTGGAGGAAT
TCACCTTTAAGATGGTCCATCAACTGGCTTCATCTTTTCAAAGAAATATACCTTTGGTTTCCAC
TCAGAAGCCAAAATAAATTCTTCCCAACATTCCATCTACTTATGAAATCGAATAATAACACAAA
ATATGTATCTGTGATGATATATTTATCATTATAGATATTATTATCAAAAATATATCTGTAATGA
TATATTTAC

hide sequence

Protein Sequences


Protein RefSeqs	NP_079743	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99445	(Get FASTA)	NCBI Sequence Viewer
	AAY24522	(Get FASTA)	NCBI Sequence Viewer
	BAB25046	(Get FASTA)	NCBI Sequence Viewer
	BAB25201	(Get FASTA)	NCBI Sequence Viewer
	BAB26008	(Get FASTA)	NCBI Sequence Viewer
	EDK99204	(Get FASTA)	NCBI Sequence Viewer
	Q9CQS6	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_079743 ⟸ NM_025467
- Peptide Label:	precursor
- UniProtKB:	Q9CQS6 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKPLVAFLVVLSIFGIQSQAEEIFNIFVPSKNGGNIQETVTIDNQQNTATINIHSGSCSSTTIF DYKHGYIASRVLSRRACYVIKMDHKAIPALDKLQRFLYEKQTMNAIDSPEYTWVRYNPLKSLIT KVDWFLFGSPIRQLCKHMPLYEGEVATKPKEVSTGACAKVGLLGILGVSICGGIHL hide sequence

RefSeq Acc Id:

ENSMUSP00000032128 ⟸ ENSMUST00000032128

Protein Domains

BRICHOS

Promoters

RGD ID:

6890324

Promoter ID:

EPDNEW_M8613

Type:

multiple initiation site

Name:

Gkn2_1

Description:

Mus musculus gastrokine 2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	87,373,365 - 87,373,425	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1913534	AgrOrtholog
Ensembl Genes	ENSMUSG00000030049	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000032128	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000032128	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	BRICHOS_dom	UniProtKB/Swiss-Prot
KEGG Report	mmu:66284	UniProtKB/Swiss-Prot
MGD	MGI:1913534	ENTREZGENE
NCBI Gene	66284	ENTREZGENE
Pfam	BRICHOS	UniProtKB/Swiss-Prot
PhenoGen	Gkn2	PhenoGen
PROSITE	BRICHOS	UniProtKB/Swiss-Prot
SMART	BRICHOS	UniProtKB/Swiss-Prot
UniProt	GKN2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)