Rtcb (RNA 2',3'-cyclic phosphate and 5'-OH ligase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rtcb (RNA 2',3'-cyclic phosphate and 5'-OH ligase) Mus musculus

Analyze

Symbol:

Rtcb

Name:

RNA 2',3'-cyclic phosphate and 5'-OH ligase

RGD ID:

1332057

MGI Page

MGI

Description:

Predicted to enable RNA ligase (ATP) activity and vinculin binding activity. Acts upstream of or within in utero embryonic development and placenta development. Located in endoplasmic reticulum membrane and nuclear envelope. Is expressed in several structures, including early conceptus and placenta. Orthologous to human RTCB (RNA 2',3'-cyclic phosphate and 5'-OH ligase).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; D10Wsu52; D10Wsu52e; FAAP; focal adhesion-associated protein; HSPC1; HSPC117; hypothetical protein LOC28088; RNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	85,774,501 - 85,793,657 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	10	85,774,501 - 85,793,687 (-)	Ensembl
GRCm38	10	85,938,637 - 85,957,793 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	85,938,637 - 85,957,823 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	85,401,382 - 85,420,538 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	10	85,368,436 - 85,387,592 (-)	NCBI			mm8
Celera	10	87,913,234 - 87,932,391 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	41.81	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

muscular dystrophy-dystroglycanopathy type B6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (ISO)

bisphenol F (ISO)

Brodifacoum (ISO)

clobetasol (EXP)

clozapine (ISO)

dexamethasone (ISO)

enzyme inhibitor (ISO)

ethanol (EXP,ISO)

flutamide (ISO)

folic acid (EXP)

indometacin (ISO)

ivermectin (ISO)

lead(0) (ISO)

lead(2+) (ISO)

methylparaben (ISO)

nefazodone (ISO)

paracetamol (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

valproic acid (ISO)

vinclozolin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

in utero embryonic development (IMP)

placenta development (IMP)

RNA processing (IEA)

tRNA exon ligation utilizing 2',3' cyclic phosphate of 5'-exon as source of linkage phosphate (IBA)

tRNA processing (IEA)

tRNA splicing, via endonucleolytic cleavage and ligation (ISO)

Cellular Component

cytoplasm (IDA,ISO)

cytosol (ISO)

endoplasmic reticulum membrane (IDA)

intracellular membrane-bounded organelle (ISO)

nuclear envelope (IDA)

nucleoplasm (ISO)

nucleus (IBA,ISO)

tRNA-splicing ligase complex (IBA,ISO)

Molecular Function

GTP binding (IEA)

ligase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

RNA ligase (ATP) activity (IBA,ISO)

RNA ligase activity (IEA)

vinculin binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

tRNA maturation pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal B cell number (IAGP)

abnormal B cell physiology (IAGP)

abnormal plasma cell morphology (IAGP)

decreased IgM level (IAGP)

References

References - curated


1.	MGD and Homologene mouse data transfer
2.	RGD automated import pipeline
3.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	RGD automated import pipeline for gene-chemical interactions
5.	Yoshihisa T Front Genet. 2014 Jul 10;5:213. doi: 10.3389/fgene.2014.00213. eCollection 2014.

Additional References at PubMed

PMID:9811942	PMID:10349636	PMID:10725249	PMID:10922068	PMID:11042159	PMID:11076861	PMID:11125038	PMID:11217851	PMID:12456657	PMID:12466851	PMID:12477932	PMID:15489334
PMID:15782199	PMID:16141072	PMID:16141073	PMID:20510672	PMID:21046479	PMID:21196315	PMID:21589869	PMID:21677750	PMID:21873635	PMID:21977911	PMID:24457600	PMID:25087875
PMID:25378478	PMID:25917546	PMID:26336360	PMID:26370502	PMID:28378742	PMID:30457570	PMID:30550785	PMID:31138677	PMID:31162944	PMID:32325033	PMID:34133714	PMID:34591784

Genomics

Comparative Map Data

Rtcb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	85,774,501 - 85,793,657 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	10	85,774,501 - 85,793,687 (-)	Ensembl
GRCm38	10	85,938,637 - 85,957,793 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	85,938,637 - 85,957,823 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	85,401,382 - 85,420,538 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	10	85,368,436 - 85,387,592 (-)	NCBI			mm8
Celera	10	87,913,234 - 87,932,391 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	41.81	NCBI

RTCB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	32,387,582 - 32,412,247 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	22	32,387,582 - 32,412,248 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	32,783,569 - 32,808,234 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	31,113,569 - 31,138,235 (-)	NCBI	NCBI36		hg18	NCBI36
Celera	22	16,585,734 - 16,610,445 (-)	NCBI
Cytogenetic Map	22	q12.3	NCBI
HuRef	22	15,740,893 - 15,765,605 (-)	NCBI		HuRef
CHM1_1	22	32,742,920 - 32,767,632 (-)	NCBI		CHM1_1

Rtcb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	17,907,786 - 17,927,134 (+)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	7	17,907,705 - 17,927,132 (+)	Ensembl
Rnor_6.0	7	23,913,830 - 23,933,191 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	23,913,830 - 23,933,191 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	24,063,354 - 24,082,716 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	20,045,978 - 20,065,340 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	7	20,059,163 - 20,079,411 (+)	NCBI
Celera	7	15,140,132 - 15,159,379 (+)	NCBI		Celera
Cytogenetic Map	7	q13	NCBI

Rtcb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	41,360,370 - 41,375,215 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955405	41,360,370 - 41,375,215 (-)	NCBI	ChiLan1.0	ChiLan1.0

RTCB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	22	31,248,280 - 31,273,030 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	31,248,280 - 31,273,030 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	22	13,394,160 - 13,418,862 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

RTCB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	31,010,841 - 31,034,208 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	31,010,878 - 31,033,229 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	30,993,808 - 31,017,083 (+)	NCBI
ROS_Cfam_1.0	10	31,853,471 - 31,876,814 (+)	NCBI
UMICH_Zoey_3.1	10	31,593,115 - 31,622,657 (+)	NCBI
UNSW_CanFamBas_1.0	10	31,882,145 - 31,905,453 (+)	NCBI
UU_Cfam_GSD_1.0	10	32,068,649 - 32,091,998 (+)	NCBI

Rtcb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	14,324,021 - 14,343,299 (+)	NCBI
SpeTri2.0	NW_004936492	7,334,420 - 7,353,745 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RTCB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	12,580,295 - 12,641,906 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	12,580,293 - 12,605,722 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	12,366,207 - 12,392,202 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RTCB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	15,216,939 - 15,243,259 (-)	NCBI	ChlSab1.1		chlSab2
ChlSab1.1 Ensembl	19	15,216,556 - 15,243,132 (-)	Ensembl	ChlSab1.1		chlSab2
Vero_WHO_p1.0	NW_023666045	110,763,914 - 110,789,838 (+)	NCBI	Vero_WHO_p1.0

Rtcb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624750	2,045,093 - 2,062,640 (+)	NCBI	HetGla_female_1.0		hetGla2

Position Markers

BB370606

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	85,959,709 - 85,959,788	UniSTS	GRCm38
MGSCv37	10	85,422,454 - 85,422,533	UniSTS	GRCm37
Celera	10	87,934,303 - 87,934,382	UniSTS
Cytogenetic Map	10	C1	UniSTS
cM Map	10	46.0	UniSTS
Whitehead/MRC_RH	10	974.64	UniSTS

RH136031

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	10	C1	UniSTS
cM Map	10	46.0	UniSTS

AI463255

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	10	85,938,781 - 85,939,002	UniSTS	GRCm38
MGSCv37	10	85,401,526 - 85,401,747	UniSTS	GRCm37
Celera	10	87,913,378 - 87,913,599	UniSTS
Cytogenetic Map	10	C1	UniSTS
cM Map	10	46.0	UniSTS
Whitehead/MRC_RH	10	973.64	UniSTS

RH126544

Mouse Assembly	Chr	Position (strand)	Source
Cytogenetic Map	10	C1	UniSTS
cM Map	10	46.0	UniSTS
Whitehead/MRC_RH	10	974.86	UniSTS

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301737	Insq9_m	insulin QTL 9 (mouse)			Not determined		10	65490938	99491121	Mouse
1558757	Eae34_m	experimental allergic encephalomyelitis susceptibility 34 (mouse)			Not determined		10	21408154	114217230	Mouse
4141382	Ssrq4_m	stress response QTL 4 (mouse)			Not determined			82490938	90856102	Mouse
4141387	Lgaq5_m	late growth adjusted QTL 5 (mouse)			Not determined			84079650	122041528	Mouse
1302035	Lmb4_m	lupus in MRL and B6 F2 cross (mouse)			Not determined		10	66848187	92258673	Mouse
1302060	El3_m	epilepsy 3 (mouse)			Not determined		10	65490938	99491121	Mouse
1302067	Scc9_m	colon tumor susceptibility 9 (mouse)			Not determined		10	18259333	125575232	Mouse
4141054	mwfh_m	modifier of white forlock hypopigmentation (mouse)			Not determined			83017003	117017136	Mouse
1301787	Bsc1_m	brain size control 1 (mouse)			Not determined		10	58516969	92517096	Mouse
1357594	Estoq3_m	embryo survival total QTL 3 (mouse)			Not determined		10	84079650	122041528	Mouse
1357622	Espq3_m	embryo survival preimplantation QTL 3 (mouse)			Not determined		10	84079650	122041528	Mouse
1357632	Vtbt9_m	vertebral trabecular bone trait 9 (mouse)			Not determined		10	75338568	109338767	Mouse
1357638	Cia29_m	collagen induced arthritis 29 (mouse)			Not determined		10	85454982	118497353	Mouse
4141479	W10q8_m	weight 10 weeks QTL 8 (mouse)			Not determined			84079650	122041528	Mouse
1300533	Aem3_m	anti-erythrocyte autoantibody modifier 3 (mouse)			Not determined		10	65490938	99491121	Mouse
1301386	Sysbp1_m	systolic blood pressure 1 (mouse)			Not determined		10	10108265	87401095	Mouse
1357740	Obsty3_m	obesity 3 (mouse)			Not determined		10	8235478	116190980	Mouse
1357779	Tesq3_m	testis weight QTL 3 (mouse)			Not determined		10	84079650	122041528	Mouse
1301165	Lith7_m	lithogenic gene 7 (mouse)			Not determined		10	82309418	116309657	Mouse
1300975	Fembrs3_m	femur breaking strength 3 (mouse)			Not determined		10	75338568	109338767	Mouse
4142137	Femwf3_m	femur work to failure 3 (mouse)			Not determined			75338568	109338767	Mouse
4142365	Egq9_m	early growth QTL 9 (mouse)			Not determined			84079650	122041528	Mouse
10043881	Adip24_m	adiposity 24 (mouse)			Not determined		10	82392803	116392952	Mouse
4142496	W6q8_m	weight 6 weeks QTL 8 (mouse)			Not determined			84079650	122041528	Mouse
26884447	Sklq9_m	skull length QTL 9, 10 week (mouse)					10	67335830	111735905	Mouse
11353832	Pcholq4_m	plasma cholesterol QTL 4 (mouse)					10	73987216	125515907	Mouse
11059551	Lmr32b_m	leishmaniasis resistance 32b (mouse)					10	82309418	116309657	Mouse
26884426	Cvht1_m	cranial vault height 1, 5 week (mouse)					10	24675898	121035905	Mouse
26884450	Sklq15_m	skull length QTL 15, 16 week (mouse)					10	59335822	122335905	Mouse
11039497	Ltpr5a_m	Leishmania tropica response 5a (mouse)					10	73506901	107507047	Mouse
12910789	Pwgrq19_m	post-weaning growth rate QTL 19 (mouse)					10	82828700	92169056	Mouse
27226764	Tibl19_m	tibia length 19, 16 week (mouse)					10	39175996	129635869	Mouse
26884430	Zlq5_m	zygomatic length QTL 5, 10 week (mouse)					10	67835830	124835905	Mouse
14700795	Mencq7_m	meniscus calcification QTL 7 (mouse)					10	85313864	86647864	Mouse
27095911	Pglq15_m	pelvic girdle length QTL 15, 16 week (mouse)					10	39175996	129635869	Mouse
26884407	Bzwq14_m	bi-zygomatic width QTL 14, 16 wee (mouse)					10	45476096	120635905	Mouse
26884424	Zlq9_m	zygomatic length QTL 9, 16 week (mouse)					10	63935779	115935905	Mouse
11059550	Lmr32a_m	leishmaniasis resistance 32a (mouse)					10	82309418	116309657	Mouse
26884403	Cvht8_m	cranial vault height 8, 16 week (mouse)					10	22875899	91035862	Mouse
26884405	Huml2_m	humerus length 2, 5 week (mouse)					10	69735830	130430862	Mouse
26884411	Bzwq8_m	bi-zygomatic width QTL 8, 10 week (mouse)					10	44876096	115935905	Mouse
11059555	Lmr32f_m	leishmaniasis resistance 32f (mouse)					10	82309418	116309657	Mouse
11059553	Lmr32d_m	leishmaniasis resistance 32d (mouse)					10	82309418	116309657	Mouse
27226772	Tibl13_m	tibia length 13, 10 week (mouse)					10	18875748	129635869	Mouse
14746991	Manh68_m	mandible shape 68 (mouse)					10	52280497	86280497	Mouse
11353843	Gluq1_m	blood glucose QTL 1 (mouse)					10	73987216	125515907	Mouse
11251717	Siim1_m	stress induced immobility 1 (mouse)					10	78381268	112381268	Mouse
13208560	Wght9_m	weight 9 (mouse)					10	59835822	120835905	Mouse
14747004	Mancz8_m	mandible centroid size 8 (mouse)					10	82078412	116078412	Mouse
11059554	Lmr32e_m	leishmaniasis resistance 32e (mouse)					10	82309418	116309657	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	231
Count of miRNA genes:	204
Interacting mature miRNAs:	216
Transcripts:	ENSMUST00000001834, ENSMUST00000139413
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC122919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC151901	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK145891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK145916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK149885	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK150376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK150470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK151042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK151182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK151932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK151988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK153434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK167643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK172175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK191745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK195665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK197044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK199892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK200437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK206521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK208576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK212007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK213387	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK216890	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK218642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY424364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003288	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000001834 ⟹ ENSMUSP00000001834

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	85,774,501 - 85,793,687 (-)	Ensembl
GRCm38.p6 Ensembl	10	85,938,637 - 85,957,823 (-)	Ensembl

RefSeq Acc Id:

ENSMUST00000139413

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	10	85,784,724 - 85,791,643 (-)	Ensembl
GRCm38.p6 Ensembl	10	85,948,860 - 85,955,779 (-)	Ensembl

RefSeq Acc Id:

NM_145422 ⟹ NP_663397

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	10	85,774,501 - 85,793,657 (-)	NCBI
GRCm38	10	85,938,637 - 85,957,793 (-)	ENTREZGENE
MGSCv37	10	85,401,382 - 85,420,538 (-)	RGD
Celera	10	87,913,234 - 87,932,391 (-)	RGD
cM Map	10		ENTREZGENE

Sequence:

show sequence

AGGCGGCGCTGCGTGGAGCGGGTGGACTGCGGGGTGGTTTCTCTTTCTAAGCGTAGCCAGGAGC
TATCGCTGGCCTCGCCGCCACCATGAGTCGTAACTACAACGATGAGCTACAGTTCTTGGACAAG
ATCAATAAAAACTGCTGGAGGATCAAGAAGGGCTTTGTGCCCAACATGCAGGTTGAAGGAGTGT
TTTATGTGAATGATGCTCTGGAAAAACTAATGTTTGAGGAATTAAGGAACGCCTGTCGAGGTGG
TGGTGTTGGTGGCTTTCTGCCAGCCATGAAGCAGATTGGCAATGTGGCAGCCCTGCCTGGAATA
GTTCATCGGTCTATCGGGCTTCCTGATGTCCATTCAGGCTATGGGTTTGCCATAGGGAACATGG
CTGCCTTTGATATGAATGACCCTGAGGCCGTTGTATCCCCAGGTGGTGTCGGATTTGATATTAA
CTGTGGTGTCCGCTTGCTAAGAACCAATTTAGATGAGAGCGATGTACAGCCTGTGAAGGAACAA
CTTGCCCAAGCTATGTTTGACCACATCCCTGTTGGGGTGGGATCAAAAGGTGTCATTCCAATGA
ATGCCAAAGACTTGGAGGAGGCATTGGAGATGGGGGTGGACTGGTCCCTGAGGGAAGGCTATGC
CTGGGCTGAAGACAAGGAGCACTGTGAGGAGTATGGAAGGATGCTGCAAGCCGACCCCAATAAG
GTCTCACCCAGGGCAAAGAAAAGGGGCCTTCCTCAGTTGGGGACCCTGGGAGCAGGCAACCATT
ATGCAGAAATCCAGGTTGTAGATGAGATTTTCAATGAGTATGCCGCCAAGAAGATGGGCATCGA
CCATAAGGGACAGGTGTGTGTGATGATCCACAGTGGAAGCAGAGGCTTGGGCCACCAAGTAGCT
ACAGATGCACTGGTAGCTATGGAAAAGGCCATGAAGAGAGACAAGATTATAGTCAATGACCGGC
AGTTGGCTTGTGCTCGGATTGCATCCCCAGAGGGACAAGACTATCTAAAGGGAATGGCTGCAGC
TGGAAACTACGCCTGGGTTAACCGCTCCTCTATGACCTTCTTAACCCGTCAGGCTTTTGCCAAA
GTCTTCAACACAACCCCTGATGACCTGGACCTGCATGTGATCTATGATGTGTCGCACAATATCG
CCAAAGTGGAGCAGCACGTGGTGGATGGGAAGGAACGGACGCTGCTGGTGCACAGGAAGGGATC
CACCCGTGCTTTCCCGCCTCACCACCCCCTCATTGCTGTGGATTATCAACTCACAGGACAACCA
GTGCTTATTGGTGGCACCATGGGGACCTGTAGTTACGTTCTGACTGGCACTGAACAAGGCATGA
CTGAGACCTTTGGAACAACCTGTCATGGAGCGGGCCGTGCTTTGTCCAGAGCAAAATCACGTCG
TAACTTAGATTTCCAAGATGTCTTAGACAAACTGGCAGACATGGGAATTGCAATCCGGGTTGCT
TCCCCCAAGCTGGTTATGGAAGAGGCACCAGAGTCCTATAAGAATGTGACAGACGTCGTGAACA
CCTGCCATGATGCTGGGATCAGCAAGAAGGCCATTAAACTGAGACCAATTGCTGTTATTAAAGG
GTAGATCCAAGACTATCAGAGCGTCTGAGGTGCCCATGGACTGAAATTCCTAAGACATGAGACT
CAAGGCCTGACAAGATCCGAATTGCAGAGCTGTTGCTGTGCGTGCCACCATGGCTGGTGGAGAG
GCTGCTGTCACAGGGTTGGAAAATAGCCTTCCAGGAGATGTGTCTCTGATGGGAGCAGGGCAAA
TGAGCCTCTTCTTCCTTTGTCCCACAGGGGTTTGTGACTGTCAATTGGGGTGTGGGAAGGGGCC
CAGAAATGCCCTGTTTGGTCATACAAGTCTGTAATCACCAGAGTGGGCTTCTTTATCCCAGGCC
CTGTTTGTAGCCCAGAAGGTATCATGGAGAACATGCTATTAAATAGGTTTTTGAATGTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_663397	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH03288	(Get FASTA)	NCBI Sequence Viewer
	AAR02005	(Get FASTA)	NCBI Sequence Viewer
	BAE26729	(Get FASTA)	NCBI Sequence Viewer
	BAE26747	(Get FASTA)	NCBI Sequence Viewer
	BAE29145	(Get FASTA)	NCBI Sequence Viewer
	BAE29508	(Get FASTA)	NCBI Sequence Viewer
	BAE29587	(Get FASTA)	NCBI Sequence Viewer
	BAE30059	(Get FASTA)	NCBI Sequence Viewer
	BAE30183	(Get FASTA)	NCBI Sequence Viewer
	BAE30808	(Get FASTA)	NCBI Sequence Viewer
	BAE30981	(Get FASTA)	NCBI Sequence Viewer
	BAE31991	(Get FASTA)	NCBI Sequence Viewer
	BAE39694	(Get FASTA)	NCBI Sequence Viewer
	BAE40021	(Get FASTA)	NCBI Sequence Viewer
	BAE42866	(Get FASTA)	NCBI Sequence Viewer
	EDL21428	(Get FASTA)	NCBI Sequence Viewer
	Q99LF4	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_663397 ⟸ NM_145422

- UniProtKB:

Q99LF4 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSRNYNDELQFLDKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLP
AMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLR
TNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEH
CEEYGRMLQADPNKVSPRAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCV
MIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVN
RSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPH
HPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDV
LDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG

hide sequence

RefSeq Acc Id:

ENSMUSP00000001834 ⟸ ENSMUST00000001834

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99LF4-F1-model_v2	AlphaFold	Q99LF4	1-505	view protein structure

Promoters

RGD ID:

6819837

Promoter ID:

MM_KWN:5191

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_145422, OTTMUST00000086251

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	10	85,420,179 - 85,420,679 (-)	MPROMDB

RGD ID:

8672926

Promoter ID:

EPDNEW_M14494

Type:

initiation region

Name:

Rtcb_1

Description:

Mus musculus RNA 2',3'-cyclic phosphate and 5'-OH ligase , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	10	85,957,751 - 85,957,811	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:106379	AgrOrtholog
Ensembl Genes	ENSMUSG00000001783	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000001834	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000001834	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.1860.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	RtcB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RtcB-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RtcB_euk	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:28088	UniProtKB/Swiss-Prot
MGD	MGI:106379	ENTREZGENE
NCBI Gene	28088	ENTREZGENE
PANTHER	PTHR11118	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RtcB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rtcb	PhenoGen
PROSITE	UPF0027	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF103365	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	Q3TJ01_MOUSE	UniProtKB/TrEMBL
	Q99LF4	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q3TA04	UniProtKB/Swiss-Prot
	Q3TI25	UniProtKB/Swiss-Prot
	Q3UDW6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-10-22	Rtcb	RNA 2',3'-cyclic phosphate and 5'-OH ligase	D10Wsu52e	DNA segment, Chr 10, Wayne State University 52, expressed	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations