OR1G1 (olfactory receptor family 1 subfamily G member 1)

Advanced Search (OLGA)

Gene: OR1G1 (olfactory receptor family 1 subfamily G member 1) Homo sapiens

Analyze

Symbol:

OR1G1

Name:

olfactory receptor family 1 subfamily G member 1

RGD ID:

1321692

HGNC Page

HGNC:8204

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

olfactory receptor 17-209; olfactory receptor 1G1; olfactory receptor 1G2; olfactory receptor OR17-8; olfactory receptor, family 1, subfamily G, member 1; olfactory receptor, family 1, subfamily G, member 2; OR17-130; OR17-209; OR1G2

RGD Orthologs

Rat

Pig

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	3,126,610 - 3,127,551 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	3,126,610 - 3,127,551 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	3,029,904 - 3,030,845 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	2,976,654 - 2,977,595 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	2,976,653 - 2,977,595	NCBI
Celera	17	3,048,125 - 3,049,066 (-)	NCBI		Celera
Cytogenetic Map	17	p13.3	NCBI
HuRef	17	2,922,153 - 2,923,094 (-)	NCBI		HuRef
CHM1_1	17	3,038,758 - 3,039,699 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	3,014,863 - 3,015,804 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (EXP)

benzo[a]pyrene (EXP)

bisphenol A (ISO)

cadmium dichloride (ISO)

CGP 52608 (EXP)

crocidolite asbestos (EXP)

geraniol (EXP)

rotenone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (NAS)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8004088	PMID:9500546	PMID:10673334	PMID:12379593	PMID:12477932	PMID:14983052	PMID:15489334	PMID:18603653	PMID:21873635	PMID:22926438	PMID:23472165	PMID:36261009

Genomics

Comparative Map Data

OR1G1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	3,126,610 - 3,127,551 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	3,126,610 - 3,127,551 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	3,029,904 - 3,030,845 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	2,976,654 - 2,977,595 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	2,976,653 - 2,977,595	NCBI
Celera	17	3,048,125 - 3,049,066 (-)	NCBI		Celera
Cytogenetic Map	17	p13.3	NCBI
HuRef	17	2,922,153 - 2,923,094 (-)	NCBI		HuRef
CHM1_1	17	3,038,758 - 3,039,699 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	3,014,863 - 3,015,804 (-)	NCBI		T2T-CHM13v2.0

Or1ad5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	35,808,668 - 35,809,579 (+)	NCBI		GRCr8
mRatBN7.2	10	35,307,662 - 35,308,573 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	35,304,703 - 35,308,919 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	40,002,346 - 40,003,257 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	39,492,659 - 39,493,570 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	34,996,031 - 34,996,942 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	36,485,605 - 36,486,516 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	36,485,605 - 36,486,516 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	36,258,381 - 36,259,292 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	36,562,740 - 36,563,651 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	36,563,788 - 36,564,700 (+)	NCBI
Celera	10	34,665,981 - 34,666,892 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

LOC110256079
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	49,127,440 - 49,132,729 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Variants

Variants in OR1G1
13 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 17p13.3(chr17:1287199-3154232)x3	copy number gain	See cases [RCV000052448]	Chr17:1287199..3154232 [GRCh38] Chr17:1190493..3057526 [GRCh37] Chr17:1137243..3004276 [NCBI36] Chr17:17p13.3	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:2357067-4328426)x3	copy number gain	See cases [RCV000052456]	Chr17:2357067..4328426 [GRCh38] Chr17:2260361..4231721 [GRCh37] Chr17:2207111..4178470 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:193307-5652222)x1	copy number loss	See cases [RCV000053384]	Chr17:193307..5652222 [GRCh38] Chr17:45835..5555542 [GRCh37] Chr17:43098..5496266 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:198748-3436345)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053386]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053386]\|See cases [RCV000053386]	Chr17:198748..3436345 [GRCh38] Chr17:50690..3339639 [GRCh37] Chr17:48539..3286389 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:2527510-3467165)x1	copy number loss	See cases [RCV000053405]	Chr17:2527510..3467165 [GRCh38] Chr17:2430804..3370459 [GRCh37] Chr17:2377554..3317209 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:3036729-3684667)x3	copy number gain	See cases [RCV000053972]	Chr17:3036729..3684667 [GRCh38] Chr17:2940023..3587961 [GRCh37] Chr17:2886773..3534710 [NCBI36] Chr17:17p13.3-13.2	uncertain significance
GRCh38/hg38 17p13.3-13.2(chr17:2062380-5258340)x1	copy number loss	See cases [RCV000133721]	Chr17:2062380..5258340 [GRCh38] Chr17:1965674..5161635 [GRCh37] Chr17:1912424..5102359 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.1(chr17:162088-6959050)x1	copy number loss	See cases [RCV000134135]	Chr17:162088..6959050 [GRCh38] Chr17:45835..6862369 [GRCh37] Chr17:11879..6803093 [NCBI36] Chr17:17p13.3-13.1	pathogenic
GRCh38/hg38 17p13.3-13.1(chr17:198748-7491129)x3	copy number gain	See cases [RCV000134970]	Chr17:198748..7491129 [GRCh38] Chr17:50690..7394448 [GRCh37] Chr17:48539..7335172 [NCBI36] Chr17:17p13.3-13.1	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:226472-3655099)x1	copy number loss	See cases [RCV000135857]	Chr17:226472..3655099 [GRCh38] Chr17:396627..3558393 [GRCh37] Chr17:76263..3505142 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:1348488-3513273)x3	copy number gain	See cases [RCV000137603]	Chr17:1348488..3513273 [GRCh38] Chr17:1251782..3416567 [GRCh37] Chr17:1198532..3363317 [NCBI36] Chr17:17p13.3-13.2	likely pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:3102273-3667053)x3	copy number gain	See cases [RCV000137331]	Chr17:3102273..3667053 [GRCh38] Chr17:3005567..3570347 [GRCh37] Chr17:2952317..3517096 [NCBI36] Chr17:17p13.3-13.2	likely pathogenic\|uncertain significance
GRCh38/hg38 17p13.3-13.1(chr17:162016-7697012)x1	copy number loss	See cases [RCV000138214]	Chr17:162016..7697012 [GRCh38] Chr17:45835..7600330 [GRCh37] Chr17:11807..7541055 [NCBI36] Chr17:17p13.3-13.1	pathogenic
GRCh38/hg38 17p13.3-12(chr17:162016-12343901)x3	copy number gain	See cases [RCV000138531]	Chr17:162016..12343901 [GRCh38] Chr17:45835..12247218 [GRCh37] Chr17:11807..12187943 [NCBI36] Chr17:17p13.3-12	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:2062429-4141883)x3	copy number gain	See cases [RCV000139738]	Chr17:2062429..4141883 [GRCh38] Chr17:1965723..4045177 [GRCh37] Chr17:1912473..3991926 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:150732-5935377)x1	copy number loss	See cases [RCV000141658]	Chr17:150732..5935377 [GRCh38] Chr17:525..5838697 [GRCh37] Chr17:525..5779421 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:237248-4735533)x1	copy number loss	See cases [RCV000141559]	Chr17:237248..4735533 [GRCh38] Chr17:396627..4638828 [GRCh37] Chr17:87039..4585577 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3(chr17:150732-3242868)x1	copy number loss	See cases [RCV000142323]	Chr17:150732..3242868 [GRCh38] Chr17:525..3146162 [GRCh37] Chr17:525..3092912 [NCBI36] Chr17:17p13.3	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:198748-4265640)x1	copy number loss	See cases [RCV000142440]	Chr17:198748..4265640 [GRCh38] Chr17:50690..4168935 [GRCh37] Chr17:48539..4115684 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh38/hg38 17p13.3-12(chr17:150732-14764202)x3	copy number gain	See cases [RCV000142236]	Chr17:150732..14764202 [GRCh38] Chr17:525..14667519 [GRCh37] Chr17:525..14608244 [NCBI36] Chr17:17p13.3-12	pathogenic
GRCh38/hg38 17p13.3-13.2(chr17:2922729-3436438)x3	copy number gain	See cases [RCV000142895]	Chr17:2922729..3436438 [GRCh38] Chr17:2826023..3339732 [GRCh37] Chr17:2772773..3286482 [NCBI36] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:919381-4046915)x3	copy number gain	See cases [RCV000240175]	Chr17:919381..4046915 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3(chr17:2804895-3058762)x3	copy number gain	See cases [RCV000445985]	Chr17:2804895..3058762 [GRCh37] Chr17:17p13.3	likely benign
GRCh37/hg19 17p13.3-13.2(chr17:1751557-5378509)x1	copy number loss	See cases [RCV000445994]	Chr17:1751557..5378509 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.1(chr17:1113102-6742486)	copy number gain	See cases [RCV000445679]	Chr17:1113102..6742486 [GRCh37] Chr17:17p13.3-13.1	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:48858-3379400)x1	copy number loss	See cases [RCV000448506]	Chr17:48858..3379400 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)	copy number gain	See cases [RCV000511439]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:525-3825428)x1	copy number loss	See cases [RCV000511508]	Chr17:525..3825428 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-12(chr17:525-15027737)x3	copy number gain	See cases [RCV000511786]	Chr17:525..15027737 [GRCh37] Chr17:17p13.3-12	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:1922768-3429136)x3	copy number gain	See cases [RCV000511855]	Chr17:1922768..3429136 [GRCh37] Chr17:17p13.3-13.2	likely pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:2339561-3447162)	copy number loss	Lissencephaly [RCV000626516]	Chr17:2339561..3447162 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:526-81041938)x3	copy number gain	See cases [RCV000512441]	Chr17:526..81041938 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:525-4151421)x3	copy number gain	See cases [RCV000512413]	Chr17:525..4151421 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-12(chr17:525-11186432)x3	copy number gain	not provided [RCV000683866]	Chr17:525..11186432 [GRCh37] Chr17:17p13.3-12	pathogenic
GRCh37/hg19 17p13.3(chr17:2834635-3206175)x3	copy number gain	not provided [RCV000683877]	Chr17:2834635..3206175 [GRCh37] Chr17:17p13.3	likely benign
GRCh37/hg19 17p13.3-13.2(chr17:2944083-3429136)x3	copy number gain	not provided [RCV000683878]	Chr17:2944083..3429136 [GRCh37] Chr17:17p13.3-13.2	uncertain significance
GRCh37/hg19 17p13.3-q25.3(chr17:12344-81057996)x3	copy number gain	not provided [RCV000739325]	Chr17:12344..81057996 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:8547-81060040)x3	copy number gain	not provided [RCV000739324]	Chr17:8547..81060040 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-q25.3(chr17:7214-81058310)x3	copy number gain	not provided [RCV000739320]	Chr17:7214..81058310 [GRCh37] Chr17:17p13.3-q25.3	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:7214-3871323)x1	copy number loss	not provided [RCV000739319]	Chr17:7214..3871323 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3(chr17:2985816-3045626)x1	copy number loss	not provided [RCV000739371]	Chr17:2985816..3045626 [GRCh37] Chr17:17p13.3	benign
GRCh37/hg19 17p13.3-13.2(chr17:2050166-4315506)x1	copy number loss	not provided [RCV000751897]	Chr17:2050166..4315506 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:47546-6287620)	copy number gain	Chromosome 17P13.3, telomeric, duplication syndrome [RCV000767586]	Chr17:47546..6287620 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:8547-5627408)x1	copy number loss	See cases [RCV001007429]	Chr17:8547..5627408 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:1095592-3484368)x3	copy number gain	not provided [RCV002472591]	Chr17:1095592..3484368 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3(chr17:2966291-3247171)x3	copy number gain	not provided [RCV001006857]	Chr17:2966291..3247171 [GRCh37] Chr17:17p13.3	likely benign
GRCh37/hg19 17p13.3-13.2(chr17:2313096-3735525)x1	copy number loss	not provided [RCV001537893]	Chr17:2313096..3735525 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:2809266-3424183)x3	copy number gain	not provided [RCV001827915]	Chr17:2809266..3424183 [GRCh37] Chr17:17p13.3-13.2	uncertain significance
GRCh37/hg19 17p13.3-13.2(chr17:2646815-3698838)x3	copy number gain	not provided [RCV001834365]	Chr17:2646815..3698838 [GRCh37] Chr17:17p13.3-13.2	uncertain significance
NC_000017.10:g.(?_2541583)_(3819519_?)del	deletion	not provided [RCV001901409]	Chr17:2541583..3819519 [GRCh37] Chr17:17p13.3-13.2	pathogenic
NC_000017.10:g.(?_1173858)_(3819519_?)dup	duplication	not provided [RCV002014058]	Chr17:1173858..3819519 [GRCh37] Chr17:17p13.3-13.2	uncertain significance
NM_003555.1(OR1G1):c.736T>A (p.Ser246Thr)	single nucleotide variant	not specified [RCV004210534]	Chr17:3126816 [GRCh38] Chr17:3030110 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.453G>A (p.Met151Ile)	single nucleotide variant	not specified [RCV004149060]	Chr17:3127099 [GRCh38] Chr17:3030393 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.194A>G (p.Asn65Ser)	single nucleotide variant	not specified [RCV004215352]	Chr17:3127358 [GRCh38] Chr17:3030652 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.25A>G (p.Ile9Val)	single nucleotide variant	not specified [RCV004109949]	Chr17:3127527 [GRCh38] Chr17:3030821 [GRCh37] Chr17:17p13.3	likely benign
NM_003555.1(OR1G1):c.736T>C (p.Ser246Pro)	single nucleotide variant	not specified [RCV004240820]	Chr17:3126816 [GRCh38] Chr17:3030110 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.627T>G (p.Ile209Met)	single nucleotide variant	not specified [RCV004186382]	Chr17:3126925 [GRCh38] Chr17:3030219 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.365G>T (p.Cys122Phe)	single nucleotide variant	not specified [RCV004174790]	Chr17:3127187 [GRCh38] Chr17:3030481 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.265A>T (p.Ser89Cys)	single nucleotide variant	not specified [RCV004077955]	Chr17:3127287 [GRCh38] Chr17:3030581 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.175A>G (p.Met59Val)	single nucleotide variant	not specified [RCV004314179]	Chr17:3127377 [GRCh38] Chr17:3030671 [GRCh37] Chr17:17p13.3	uncertain significance
GRCh38/hg38 17p13.3-12(chr17:165730-11404096)x3	copy number gain	Chromosome 17p13.3 duplication syndrome [RCV003327726]	Chr17:165730..11404096 [GRCh38] Chr17:17p13.3-12	pathogenic
NM_003555.1(OR1G1):c.923G>A (p.Arg308Gln)	single nucleotide variant	not specified [RCV004338531]	Chr17:3126629 [GRCh38] Chr17:3029923 [GRCh37] Chr17:17p13.3	uncertain significance
Single allele	deletion	not provided [RCV003448682]	Chr17:2..4611147 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:2433587-3484368)x1	copy number loss	not provided [RCV003483311]	Chr17:2433587..3484368 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:526-3441645)x1	copy number loss	not provided [RCV003483307]	Chr17:526..3441645 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:9474-6017500)x1	copy number loss	not specified [RCV003987214]	Chr17:9474..6017500 [GRCh37] Chr17:17p13.3-13.2	pathogenic
GRCh37/hg19 17p13.3-11.2(chr17:525-21510992)x3	copy number gain	not specified [RCV003987215]	Chr17:525..21510992 [GRCh37] Chr17:17p13.3-11.2	pathogenic
GRCh37/hg19 17p13.3-13.2(chr17:2674657-3484368)x3	copy number gain	not specified [RCV003987223]	Chr17:2674657..3484368 [GRCh37] Chr17:17p13.3-13.2	uncertain significance
NM_003555.1(OR1G1):c.562T>C (p.Ser188Pro)	single nucleotide variant	not specified [RCV004501759]	Chr17:3126990 [GRCh38] Chr17:3030284 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.326T>C (p.Met109Thr)	single nucleotide variant	not specified [RCV004501757]	Chr17:3127226 [GRCh38] Chr17:3030520 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.850A>G (p.Met284Val)	single nucleotide variant	not specified [RCV004501760]	Chr17:3126702 [GRCh38] Chr17:3029996 [GRCh37] Chr17:17p13.3	uncertain significance
NC_000017.10:g.(?_422368)_(8285628_?)dup	duplication	not provided [RCV004581443]	Chr17:422368..8285628 [GRCh37] Chr17:17p13.3-13.1	uncertain significance
NM_003555.1(OR1G1):c.35G>C (p.Cys12Ser)	single nucleotide variant	not specified [RCV004655330]	Chr17:3127517 [GRCh38] Chr17:3030811 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.363C>G (p.Asp121Glu)	single nucleotide variant	not specified [RCV004655331]	Chr17:3127189 [GRCh38] Chr17:3030483 [GRCh37] Chr17:17p13.3	uncertain significance
NM_003555.1(OR1G1):c.210T>A (p.Asp70Glu)	single nucleotide variant	not specified [RCV004646258]	Chr17:3127342 [GRCh38] Chr17:3030636 [GRCh37] Chr17:17p13.3	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	98
Count of miRNA genes:	95
Interacting mature miRNAs:	98
Transcripts:	ENST00000328890
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Markers in Region

UniSTS:480490

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	17	3,029,904 - 3,030,845	UniSTS	GRCh37
Celera	17	3,048,125 - 3,049,066	UniSTS
HuRef	17	2,922,153 - 2,923,094	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
99	141	207	121	923	172	240	31	150	18	258	506	485	1	776	123	559	172	13

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_003555	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF087928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC069379	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC095520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BK004243	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KP290512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U04689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U53583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U86240	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000328890 ⟹ ENSP00000331545

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	17	3,126,610 - 3,127,551 (-)	Ensembl

RefSeq Acc Id:

NM_003555 ⟹ NP_003546

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	17	3,126,610 - 3,127,551 (-)	NCBI
GRCh37	17	3,029,904 - 3,030,845 (-)	RGD
Build 36	17	2,976,654 - 2,977,595 (-)	NCBI Archive
Celera	17	3,048,125 - 3,049,066 (-)	RGD
HuRef	17	2,922,153 - 2,923,094 (-)	RGD
CHM1_1	17	3,038,758 - 3,039,699 (-)	NCBI
T2T-CHM13v2.0	17	3,014,863 - 3,015,804 (-)	NCBI

Sequence:

show sequence

ATGGAGGGGAAAAATCTGACCAGCATCTCAGAATGTTTCCTCCTGGGGTTCTCTGAGCAGCTGG
AGGAGCAGAAGCCCCTCTTTGGGTCCTTCCTGTTCATGTACTTGGTCACGGTGGCAGGCAACCT
CCTCATCATTCTAGTCATCATTACTGACACTCAACTCCATACCCCCATGTACTTCTTTCTAGCC
AACCTCTCCCTTGCAGATGCCTGCTTTGTGTCCACCACAGTCCCTAAGATGCTGGCAAACATAC
AGATCCAGAGTCAGGCCATCTCCTACTCAGGGTGTCTACTACAGTTGTATTTTTTCATGTTATT
TGTGATGCTGGAGGCATTCCTCTTGGCGGTCATGGCCTATGACTGCTACGTGGCCATATGCCAC
CCACTTCATTACATTCTGATCATGAGCCCTGGGCTCTGCATCTTCCTCGTGTCTGCATCCTGGA
TCATGAATGCCCTCCACTCCCTTCTACACACACTTCTGATGAACAGCCTGTCCTTCTGCGCAAA
CCATGAGATCCCACACTTCTTCTGTGACATCAATCCCCTCCTGAGTCTGTCCTGCACAGACCCC
TTCACCAATGAGCTGGTGATCTTCATCACTGGGGGTCTCACAGGACTCATTTGTGTGCTTTGCC
TGATTATCTCTTACACGAACGTTTTCTCGACCATCCTGAAGATCCCATCAGCTCAGGGGAAGCG
GAAAGCCTTTTCCACCTGCAGCTCTCATCTCTCCGTGGTCTCTCTCTTCTTTGGGACTTCTTTT
TGTGTTGATTTCAGTTCTCCCTCAACCCACTCGGCCCAGAAGGACACAGTTGCATCAGTGATGT
ACACAGTGGTAACTCCAATGTTGAATCCCTTTATCTACAGTTTGAGGAACCAAGAAATAAAGTC
TTCCCTGAGAAAGTTAATCTGGGTTCGGAAAATTCATTCCCCTTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_003546	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA18352	(Get FASTA)	NCBI Sequence Viewer
	AAC39620	(Get FASTA)	NCBI Sequence Viewer
	AAC99556	(Get FASTA)	NCBI Sequence Viewer
	AAF37317	(Get FASTA)	NCBI Sequence Viewer
	AAH69379	(Get FASTA)	NCBI Sequence Viewer
	AAH95520	(Get FASTA)	NCBI Sequence Viewer
	ALI87674	(Get FASTA)	NCBI Sequence Viewer
	DAA04641	(Get FASTA)	NCBI Sequence Viewer
	EAW90523	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000331545
	ENSP00000331545.2
GenBank Protein	P47890	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_003546 ⟸ NM_003555

- UniProtKB:

Q6IFL9 (UniProtKB/Swiss-Prot), Q4VBM1 (UniProtKB/Swiss-Prot), Q9UM76 (UniProtKB/Swiss-Prot), P47890 (UniProtKB/Swiss-Prot), A0A126GW57 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGKNLTSISECFLLGFSEQLEEQKPLFGSFLFMYLVTVAGNLLIILVIITDTQLHTPMYFFLA
NLSLADACFVSTTVPKMLANIQIQSQAISYSGCLLQLYFFMLFVMLEAFLLAVMAYDCYVAICH
PLHYILIMSPGLCIFLVSASWIMNALHSLLHTLLMNSLSFCANHEIPHFFCDINPLLSLSCTDP
FTNELVIFITGGLTGLICVLCLIISYTNVFSTILKIPSAQGKRKAFSTCSSHLSVVSLFFGTSF
CVDFSSPSTHSAQKDTVASVMYTVVTPMLNPFIYSLRNQEIKSSLRKLIWVRKIHSP

hide sequence

Ensembl Acc Id:

ENSP00000331545 ⟸ ENST00000328890

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P47890-F1-model_v2	AlphaFold	P47890	1-313	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:8204	AgrOrtholog
COSMIC	OR1G1	COSMIC
Ensembl Genes	ENSG00000183024	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000328890	ENTREZGENE
	ENST00000328890.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000183024	GTEx
HGNC ID	HGNC:8204	ENTREZGENE
Human Proteome Map	OR1G1	Human Proteome Map
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:8390	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	8390	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORY RECEPTOR 1G1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA32076	PharmGKB
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A126GW57	ENTREZGENE, UniProtKB/TrEMBL
	OR1G1_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
	Q4VBM1	ENTREZGENE
	Q6IFL9	ENTREZGENE
	Q9UM76	ENTREZGENE
UniProt Secondary	Q4VBM1	UniProtKB/Swiss-Prot
	Q6IFL9	UniProtKB/Swiss-Prot
	Q9UM76	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-15	OR1G1	olfactory receptor family 1 subfamily G member 1	OR1G1	olfactory receptor, family 1, subfamily G, member 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message