Mtap (methylthioadenosine phosphorylase)

Advanced Search (OLGA)

Gene: Mtap (methylthioadenosine phosphorylase) Mus musculus

Analyze

Symbol:

Mtap

Name:

methylthioadenosine phosphorylase

RGD ID:

1320831

MGI Page

MGI

Description:

Predicted to enable S-methyl-5-thioadenosine phosphorylase activity. Acts upstream of or within methylation. Predicted to be located in nucleoplasm. Predicted to be active in cytosol. Is expressed in several structures, including alimentary system; brain; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in biliary tract benign neoplasm and diaphyseal medullary stenosis with malignant fibrous histiocytoma. Orthologous to human MTAP (methylthioadenosine phosphorylase).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1300019I21Rik; 5'-methylthioadenosine phosphorylase; MSAP; MTA phosphorylase; MTAPase; S-methyl-5'-thioadenosine phosphorylase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MTAP (methylthioadenosine phosphorylase)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Mtap (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mtap (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MTAP (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MTAP (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mtap (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MTAP (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MTAP (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mtap (methylthioadenosine phosphorylase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Mtap (methylthioadenosine phosphorylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MTAP (methylthioadenosine phosphorylase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mtap (methylthioadenosine phosphorylase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	CG31115	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	B0228.7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MEU1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Mtap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rgs1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mtap	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Gm18645 Gm4914

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	89,055,607 - 89,099,327 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	89,055,359 - 89,099,318 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	89,137,370 - 89,181,090 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	89,137,122 - 89,181,081 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	88,783,274 - 88,826,994 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	88,608,657 - 88,652,314 (+)	NCBI		MGSCv36	mm8
Celera	4	87,620,095 - 87,663,899 (+)	NCBI		Celera
Cytogenetic Map	4	C4	NCBI
cM Map	4	42.15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

biliary tract benign neoplasm (ISO)

common bile duct neoplasm (ISO)

diaphyseal medullary stenosis with malignant fibrous histiocytoma (ISO)

melanoma (ISO)

Nevus (ISO)

pancreatic cancer (ISO)

Prostatic Neoplasms (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (EXP)

1,2-dimethylhydrazine (EXP)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

4-hydroxyphenyl retinamide (EXP)

5-fluorouracil (ISO)

acrolein (ISO)

acrylamide (ISO)

alpha-pinene (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (EXP)

arsenous acid (ISO)

benzo[a]pyrene (EXP,ISO)

beta-lapachone (ISO)

bisphenol A (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

choline (EXP)

clofibrate (EXP)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (EXP,ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dichloroacetic acid (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (EXP)

ethyl methanesulfonate (ISO)

flutamide (ISO)

folic acid (EXP)

formaldehyde (ISO)

gentamycin (ISO)

inulin (EXP)

ivermectin (ISO)

L-methionine (EXP)

manganese(II) chloride (ISO)

methidathion (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

oxaliplatin (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (EXP)

perfluorooctane-1-sulfonic acid (EXP)

pirinixic acid (EXP)

SB 431542 (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

tamoxifen (EXP)

tanespimycin (ISO)

temozolomide (ISO)

tetrachloromethane (EXP)

thioacetamide (ISO)

titanium dioxide (EXP)

tolcapone (ISO)

topotecan (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

L-methionine salvage from methylthioadenosine (IBA)

methylation (IMP)

nicotinamide riboside catabolic process (ISO)

nucleoside metabolic process (IEA)

purine ribonucleoside salvage (IEA)

response to testosterone (ISO)

Cellular Component

cytoplasm (IEA)

cytosol (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

catalytic activity (IEA)

glycosyltransferase activity (IEA)

pentosyltransferase activity (IEA)

protein binding (ISO)

S-methyl-5-thioadenosine phosphorylase activity (IBA,IEA,ISO)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cysteine and methionine metabolic pathway (IEA)

glycine N-methyltransferase deficiency pathway (ISO)

homocystinuria pathway (ISO)

hypermethioninemia pathway (ISO)

methionine cycle/metabolic pathway (ISO)

methylenetetrahydrofolate reductase deficiency pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal allantois morphology (IEA)

abnormal bronchus morphology (IAGP)

abnormal chorioallantoic fusion (IEA)

abnormal heart morphology (IEA)

abnormal liver morphology (IAGP)

abnormal lymph node morphology (IEA)

abnormal skin morphology (IEA)

abnormal spleen morphology (IEA)

abnormal thymus morphology (IEA)

abnormal visceral yolk sac morphology (IEA)

abnormal vitelline vasculature morphology (IEA)

abnormal vitreous body morphology (IEA)

arteritis (IAGP)

cataract (IEA)

embryonic growth retardation (IEA)

embryonic lethality between somite formation and embryo turning, complete penetrance (IAGP)

enlarged heart (IEA)

enlarged lymph nodes (IEA)

enlarged spleen (IEA)

enlarged thymus (IEA)

preweaning lethality, complete penetrance (IEA)

small liver (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Aminooxy analogues of spermidine as inhibitors of spermine synthase and substrates of hepatic polyamine acetylating activity.	Eloranta TO, etal., J Biochem. 1990 Oct;108(4):593-8.
2.	Homozygous deletion of the MTAP gene in invasive adenocarcinoma of the pancreas and in periampullary cancer: a potential new target for therapy.	Hustinx SR, etal., Cancer Biol Ther. 2005 Jan;4(1):83-6. Epub 2005 Jan 15.
3.	Homozygous deletions of methylthioadenosine phosphorylase in human biliary tract cancers.	Karikari CA, etal., Mol Cancer Ther. 2005 Dec;4(12):1860-6.
4.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
5.	S-adenosylmethionine in liver health, injury, and cancer.	Lu SC and Mato JM, Physiol Rev. 2012 Oct;92(4):1515-42. doi: 10.1152/physrev.00047.2011.
6.	MGDs mouse GO annotations	MGD data from the GO Consortium
7.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Loss of methylthioadenosine phosphorylase and elevated ornithine decarboxylase is common in pancreatic cancer.	Subhi AL, etal., Clin Cancer Res. 2004 Nov 1;10(21):7290-6.

Additional References at PubMed

PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:12477932	PMID:12520002	PMID:12618140	PMID:12824877	PMID:14681479	PMID:15489334	PMID:15782199	PMID:16141072
PMID:16141073	PMID:17534888	PMID:17967808	PMID:18237276	PMID:18287559	PMID:18307411	PMID:18346207	PMID:19423573	PMID:19491104	PMID:19567676	PMID:21267068	PMID:21327095
PMID:21491542	PMID:21677750	PMID:21873635	PMID:22952318	PMID:23840755	PMID:24324622	PMID:26819315	PMID:28378742	PMID:30333137	PMID:30550785	PMID:32325033	PMID:34321999
PMID:36114006	PMID:38355793

Genomics

Comparative Map Data

Mtap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	89,055,607 - 89,099,327 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	89,055,359 - 89,099,318 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	89,137,370 - 89,181,090 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	89,137,122 - 89,181,081 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	88,783,274 - 88,826,994 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	88,608,657 - 88,652,314 (+)	NCBI		MGSCv36	mm8
Celera	4	87,620,095 - 87,663,899 (+)	NCBI		Celera
Cytogenetic Map	4	C4	NCBI
cM Map	4	42.15	NCBI

MTAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	21,802,636 - 21,941,115 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	21,802,636 - 21,937,651 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	21,802,635 - 21,941,114 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	21,792,635 - 21,855,970 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	21,792,634 - 21,855,967	NCBI
Celera	9	21,740,998 - 21,804,334 (+)	NCBI		Celera
Cytogenetic Map	9	p21.3	NCBI
HuRef	9	21,765,963 - 21,829,332 (+)	NCBI		HuRef
CHM1_1	9	21,802,515 - 21,865,858 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	21,816,863 - 21,955,417 (+)	NCBI		T2T-CHM13v2.0

Mtap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	108,990,270 - 109,036,494 (+)	NCBI		GRCr8
mRatBN7.2	5	103,874,460 - 103,920,684 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	103,873,020 - 103,939,406 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	106,308,258 - 106,354,482 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	108,037,874 - 108,084,086 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	108,118,643 - 108,164,834 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	107,711,077 - 107,777,530 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	107,711,077 - 107,777,530 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	111,679,661 - 111,746,208 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	108,788,725 - 108,861,905 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	108,793,950 - 108,867,131 (+)	NCBI
Celera	5	102,587,860 - 102,654,739 (+)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI

Mtap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	12,390,032 - 12,439,206 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	12,391,399 - 12,439,221 (-)	NCBI	ChiLan1.0	ChiLan1.0

MTAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	102,620,519 - 102,756,196 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	102,623,086 - 102,762,138 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	21,637,543 - 21,769,698 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	22,253,357 - 22,316,883 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	22,266,376 - 22,382,218 (+)	Ensembl	panpan1.1		panPan2

MTAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	41,148,389 - 41,200,635 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	41,148,404 - 41,264,504 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	39,820,541 - 39,872,745 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	42,090,758 - 42,142,952 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	42,090,124 - 42,142,944 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	40,760,953 - 40,813,082 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	40,648,752 - 40,701,001 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	41,262,101 - 41,314,256 (+)	NCBI		UU_Cfam_GSD_1.0

Mtap
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	155,762,052 - 155,800,008 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936652	3,431,171 - 3,472,071 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936652	3,431,588 - 3,468,770 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTAP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	200,882,956 - 200,934,445 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	200,882,954 - 200,934,389 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	224,075,795 - 224,126,822 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTAP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	84,196,548 - 84,198,357 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	57,997,427 - 58,050,241 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	57,778,455 - 57,780,270 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtap
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	25,778,240 - 25,826,530 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624736	25,778,191 - 25,826,945 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mtap
1829 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	453
Count of miRNA genes:	340
Interacting mature miRNAs:	361
Transcripts:	ENSMUST00000058030, ENSMUST00000134429
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
11532714	Sluc43_m	susceptibility to lung cancer 43 (mouse)					4	46642108	123127211	Mouse
13506251	Cytrq1_m	cytokine response QTL 1 (mouse)					4	65718086	99718086	Mouse
4141623	W6q13_m	weight 6 weeks QTL 13 (mouse)			Not determined			88982069	140468203	Mouse
25314312	Syncl2_m	synaptonemal complex length 2 (mouse)					4	65718237	146584457	Mouse
1357726	Lnopy1_m	lens opacity 1 (mouse)			Not determined		4	85428838	119429037	Mouse
11532708	Sluc43i_m	susceptibility to lung cancer 43i (mouse)					4	74444699	108444983	Mouse
11532707	Sluc43h_m	susceptibility to lung cancer 43h (mouse)					4	74444699	108444983	Mouse
11532706	Sluc43c_m	susceptibility to lung cancer 43c (mouse)					4	74444699	108444983	Mouse
27226770	Tibl11_m	tibia length 11, 10 week (mouse)					4	88518237	108357197	Mouse
11532705	Sluc43b_m	susceptibility to lung cancer 43b (mouse)					4	74444699	108444983	Mouse
10412176	Habiir3_m	hyperoxic acute lung injury imprinted region 3 (mouse)			Not determined		4	83757130	94293740	Mouse
1302044	Nss1_m	NOD Sjogren's syndrome 1 (mouse)			Not determined		4	71982069	105982216	Mouse
11532704	Sluc43a_m	susceptibility to lung cancer 43a (mouse)					4	74444699	108444983	Mouse
27226766	Tibl17_m	tibia length 17, 16 week (mouse)					4	88518237	108457197	Mouse
4141093	W3q17_m	weight 3 weeks QTL 17 (mouse)			Not determined			88982069	140468203	Mouse
1302031	Bulb1_m	bulb size 1 (mouse)			Not determined		4	74033887	108034029	Mouse
27095939	Ulnl9_m	ulna length 9, 16 week (mouse)					4	65318237	118857197	Mouse
27095938	Ulnl6_m	ulna length 6, 10 week (mouse)					4	66718237	98588237	Mouse
11567249	Elorr3_m	ethanol induced loss of righting response 3 (mouse)					4	3722677	156268235	Mouse
12904933	Edlmmq3_m	extensor digitorum longus muscle mass QTL 3 (mouse)					4	81213991	115213991	Mouse
10043964	Obq26_m	obesity QTL 26 (mouse)			Not determined		4	59047251	93047251	Mouse
1301556	Cd4vts1_m	CD4 virgin T cell subset 1 (mouse)			Not determined		4	85428838	119429037	Mouse
26884406	Huml3_m	humerus length 3, 10 week (mouse)					4	75618237	100157197	Mouse
1301823	Bmd7_m	bone mineral density 7 (mouse)			Not determined		4	88982069	151654550	Mouse
27226801	Feml6_m	femur length 6, 5 week (mouse)					4	87518237	103257197	Mouse
1302204	Spm1_m	splenomegaly modifier (mouse)			Not determined		4	82244395	116244582	Mouse
11532703	Sluc43g_m	susceptibility to lung cancer 43g (mouse)					4	74444699	108444983	Mouse
11532702	Sluc43f_m	susceptibility to lung cancer 43f (mouse)					4	74444699	108444983	Mouse
11532701	Sluc43e_m	susceptibility to lung cancer 43e (mouse)					4	74444699	108444983	Mouse
1558948	Ath8_m	atherosclerosis 8 (mouse)			Not determined		4	45658442	105156995	Mouse
11532700	Sluc43d_m	susceptibility to lung cancer 43d (mouse)					4	74444699	108444983	Mouse
11039517	Ltpr4_m	Leishmania tropica response 4 (mouse)					4	79365751	113365867	Mouse
11039504	Ltpr4a_m	Leishmania tropica response 4a (mouse)					4	79365751	113365867	Mouse
11039505	Ltpr4c_m	Leishmania tropica response 4c (mouse)					4	79365751	113365867	Mouse
1301930	Papg1_m	pulmonary adenoma progression 1 (mouse)			Not determined		4	85781167	119781279	Mouse
1301033	Abbp2_m	A/J and C57BL/6 blood pressure 2 (mouse)			Not determined		4	53550839	93763305	Mouse
1357870	Pfat1_m	predicted fat percentage 1 (mouse)			Not determined		4	63619526	97619685	Mouse
1302057	Pgia27_m	proteoglycan induced arthritis 27 (mouse)			Not determined		4	70067227	104067464	Mouse
1301545	Gauc_m	glucose area under curve (mouse)			Not determined		4	76763107	110763305	Mouse
11039506	Ltpr4b_m	Leishmania tropica response 4b (mouse)					4	79365751	113365867	Mouse
27226787	Feml14_m	femur length 14, 10 week (mouse)					4	84918237	107157197	Mouse
10412193	Plep_m	plasma lepin levels (mouse)			Not determined		4	74444699	108444983	Mouse
27095900	Scvln9_m	sacral vertebrae length 2, 10 week (mouse)					4	68018237	107157197	Mouse
39128212	Lwq21_m	liver weight QTL 21 (mouse)					4	88982069	140468203	Mouse
27226716	Metcl2_m	metatarsal-calcaneal length 2, 5 week (mouse)					4	88118237	118557197	Mouse
26884445	Sklq7_m	skull length QTL 7, 10 week (mouse)					4	68018237	150884457	Mouse
26884434	Zlq1_m	zygomatic length QTL 1, 5 week (mouse)					4	53700000	103257197	Mouse
26884435	Zlq4_m	zygomatic length QTL 4, 10 week (mouse)					4	85118237	104957197	Mouse
1300697	Sle2_m	systemic lupus erythmatosus susceptibility 2 (mouse)			Not determined		4	77957579	111957775	Mouse
1301597	Anxty_m	anxiety (mouse)			Not determined		4	74137574	128009280	Mouse
26884437	Sklq13_m	skull length QTL 13, 16 week (mouse)					4	57700000	155684457	Mouse
12880404	Embq1_m	emotional behavior QTL 1 (mouse)					4	65757203	95921546	Mouse
4141549	W10q10_m	weight 10 weeks QTL 10 (mouse)			Not determined			88982069	140468203	Mouse
1357895	Ctrcts_m	cataract severity (mouse)			Not determined		4	45709925	138342753	Mouse
1301190	Cd4ts2_m	CD4 T cell subset 2 (mouse)			Not determined		4	60145277	94145424	Mouse
26884431	Zlq8_m	zygomatic length QTL 8, 16 week (mouse)					4	74718237	108357197	Mouse
1357507	Synch2_m	synechia 2 (mouse)			Not determined		4	60145277	94145424	Mouse
12879903	Berr8_m	berghei resistance locus 8 (mouse)					4	64222460	98222460	Mouse
12879897	Berr4_m	berghei resistance locus 4 (mouse)					4	71982069	105982216	Mouse
4142047	Mvwf3_m	modifier of von Willebrand factor 3 (mouse)			Not determined			14010457	117072206	Mouse
27095934	Ulnl2_m	ulna length 2, 5 week (mouse)					4	57700000	94788237	Mouse
27226746	Metcl8_m	metatarsal-calcaneal length 8, 10 week (mouse)					4	87518237	107157197	Mouse
12904738	Idohtq_m	iris defect with ocular hypertension QTL (mouse)					4	80752467	93112991	Mouse
27095924	Pglq2_m	pelvic girdle length QTL 2, 5 week (mouse)					4	69118237	130727311	Mouse
27095927	Pglq7_m	pelvic girdle length QTL 7, 10 week (mouse)					4	88118237	108357197	Mouse
1300601	Tlsr1_m	thymic lymphoma suppressor region 1 (mouse)			Not determined		4	88601158	94957775	Mouse
27095921	Pglq12_m	pelvic girdle length QTL 12, 16 week (mouse)					4	83118237	108357197	Mouse
27226739	Metcl14_m	metatarsal-calcaneal length 14, 16 week (mouse)					4	87518237	108357197	Mouse
1357561	Mbsyd_m	metabolic syndrome (mouse)			Not determined		4	66888445	100888588	Mouse
1301118	Bbaa23_m	B.burgdorferi-associated arthritis 23 (mouse)			Not determined		4	85781167	119781279	Mouse
11532738	Abd1_m	autoimmune biliary disease 1 (mouse)					4	88982069	116271120	Mouse
1301757	Tlsr4_m	thymic lymphoma suppressor region 4 (mouse)			Not determined		4	66757130	100757258	Mouse
27095917	Scvln14_m	sacral vertebrae length 2, 16 week (mouse)					4	68018237	130277062	Mouse
4141900	Skts-fp1_m	skin tumor susceptibility in FVB and PWK 1 (mouse)			Not determined		4	53550839	124055180	Mouse
1300966	Pabr2_m	plasma apolipoprotein B (human) regulator 2 (mouse)			Not determined		4	46332646	105801860	Mouse
1301739	Pitm2_m	prion incubation time 2 (mouse)			Not determined		4	71982069	105982216	Mouse
1301867	Idd11_m	insulin dependent diabetes susceptibility 11 (mouse)			Not determined		4	83604870	117605006	Mouse
26884449	Sklq2_m	skull length QTL 2, 5 week (mouse)					4	36700000	128993793	Mouse
27226724	Tibw2_m	tibia width 2, proximal, 10 week (mouse)					4	43000000	108357197	Mouse
27095905	Scvln3_m	sacral vertebrae length 2, 5 week (mouse)					4	55600000	128993793	Mouse

Markers in Region

AI326792

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	89,179,990 - 89,180,126	UniSTS	GRCm38
MGSCv37	4	88,825,894 - 88,826,030	UniSTS	GRCm37
Celera	4	87,662,799 - 87,662,935	UniSTS
Cytogenetic Map	4	C4	UniSTS
Whitehead/MRC_RH	4	1224.5	UniSTS

RH135876

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	89,156,443 - 89,156,565	UniSTS	GRCm38
MGSCv37	4	88,802,347 - 88,802,469	UniSTS	GRCm37
Celera	4	87,639,175 - 87,639,297	UniSTS
Cytogenetic Map	4	C4	UniSTS

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024433	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB056100	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK005064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK011421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK089916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK159515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK167319	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK194742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL831719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003858	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000058030 ⟹ ENSMUSP00000061092

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	89,055,359 - 89,099,318 (+)	Ensembl
GRCm38.p6 Ensembl	4	89,137,122 - 89,181,081 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000204571

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	4	89,094,611 - 89,097,711 (+)	Ensembl
GRCm38.p6 Ensembl	4	89,176,374 - 89,179,474 (+)	Ensembl

RefSeq Acc Id:

NM_024433 ⟹ NP_077753

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	4	89,055,607 - 89,099,327 (+)	NCBI
GRCm38	4	89,137,370 - 89,181,090 (+)	ENTREZGENE
MGSCv37	4	88,783,274 - 88,826,994 (+)	RGD
Celera	4	87,620,095 - 87,663,899 (+)	RGD
cM Map	4		ENTREZGENE

Sequence:

show sequence

GGGAGGAAGAGGAGGAGCCAGAGCCCGTGGGTCCCCGCACTGCTCACTCCCGCGCCACGCCGGC
CCCGCAGTCTCCTCCCGGTCCCACGCTGCGGCCCGCTGTGGACTTCCCTGGTGCAGACATGGCC
TCGGGCTCCGCCTGCACGGCGGTGAAGATTGGAATAATTGGTGGAACAGGCTTGGATGATCCCG
AAATTTTAGAAGGAAGAACTGAGAAATATGTGGATACTCCATTCGGCAAGCCATCCGATGCCTT
AATTTTGGGGAAGATAAAGAACGTTGATTGTGTACTTCTTGCAAGACACGGCAGACAACACACC
ATCATGCCTTCAAAAGTCAACTACCAGGCAAACATCTGGGCCTTGAAGGAAGAGGGCTGTACAC
ATGTCATCGTGACCACAGCTTGCGGGTCCTTGAGAGAGGAGATCCAGCCTGGTGACATGGTCAT
CATTGACCAATTCATTGACAGGACATCCCTAAGGCCTCAGACCTTCTATGATGGGAGTCATTGC
AGTGCCAGAGGAGTGTGCCACATCCCCATGGCTGAACCGTTTTGCCCCAAAACAAGAGAGGTCC
TCATAGAAACTGCTAAGAAGCTAGGACTTCGGTGCCATTCAAAGGGGACAATAGTCACAATTGA
GGGGCCCCGTTTCAGCTCCCGGGCAGAAAGCCTTATATTCCGTACTTGGGGCGCAGATGTTGTC
AACATGACCACTGTTCCAGAGGTGGTACTTGCTAAGGAGGCTGGAATTTGCTATGCAAGCATTG
CCATGGCAACCGACTATGATTGTTGGAAGGAGCATGAAGAAGCAGTGTCAGTGGATGGGGTTTT
AAAGACCATGAAAGAAAATGCCAATAAAGCCAAAAGTTTACTCCTCACTACTATACCTCAGATA
GGGTCGATGGAATGGTCAGAAACGCTCCGTAACCTAAAGAACATGGCCCAGTTTTCCGTTTTAC
CACCAAGACATTAAAACAGCATGGCTGACACAAGAAGACGTTCTACTTCTAGTCTTTGGGGGAT
TTTGCTTAAACAAAAATGGGAAAGATCCGCAGCCTTCATGCCTTTGCCTAGAAAGAAAGACACT
GTTAGCGACTCAACCAAGATCCCAACTCCTCCGGGACCCAGAAGGAAAGCAGACAGCCTGCCAA
ACAGAGCCGGAGAGCACATCTGTCTCACTTTCCCTATTAAACTGACAACAAGGATTACTAGTGA
AAACATCCACTACCCTACAGCGCTAAGGAGCCAATACGAGCTCGAGATGGGACTGTGTGATTGT
AAACTGGCGCCATGTTTCCGACACTTGGTATTCTAAGAGTTTCTCTTGAAGAAGTTATGAGATA
TTCCTTCAAAGAATCATGTGTAAAGAAGAATATTACCTGCCATAGTAAAATAATCAAAACTATC
TGAATATCAAAAAAAATTAGCTGTGCCGTGTTTCCGTTATACTTAGGTTATGGAGCAATCAAGT
GGAAATCATGTTTCCTCACGAAGAAATGATTAATCTTTTTCTCTACTTTTAAATATAATCAAAT
AATAAAGCTGTAAAAATTAAAATGGACTTAGAGAACTTTGAAACTCCTTTGGTGGTGAAGTGAA
GACAACAACAATAATATAACTGCGCTGTGTATGTGAATCAAGATATATAAGCCAAATAACCCCC
TTTCCCAAATAAAGAAATAAAGGAAAATGCTGTGTGAGGAGCTTACTAAACCTTTGCTAAGAAA
GATCCTGGGTCACCACACAGCTAAGATGATGTAACTGAGAAAGCCAAGGCCGGTGTTTAATGCA
AGCCAGTGTGACTCATCACAGTGTATCGAGAGTTGACACATAATCAGTTGGCAATTTTTTTCTT
TTGTTTAAAAGAAGAAAGTAGAAGCCTAACTTTTTATTTTTCAAATTACTGTTGTTACAGGTGC
CCTACAGCGCCCGTAAAGGGTCTGTAAAGTGAGTGTGCCTGTGTCTGAAATTGACTTCAAGATA
ATAAGCTGTTGATTGTAAGCAATAAATGAATTATTTGCTCCAGTGTTAATGTCGAGCGAGGCCC
TGGATAAGTGCAATTGTTACTTCCGCCCATGTTGCAGTGCTCCCATCTCTGGCTGTAAGCAGTC
CGTGGAGACTCCGTGAGGCCTGATCAGGGCTTTAGGTTGTTTTTACTCACTGCAGTGTCAACAC
TTCTTTCCCCTTAGCCACTGCGGGGTGGGCATCCGTTTTGTTGCCTTTAGAAAATGCTGCTCTC
TTCAACATGGAGAATGACTTTCTTCAGTGGCCTTTCTAGCATCATGTGCAGGCTTCTTCCCCTT
TTCCTTAATCCTTCATCATGATGAAACATGCATATAATCACTGGGTCTGGCTCAACATGATGCT
GTCCGTTCTGTCCATCTTCCTACGGGTATCGTAATTCCATTCTTTTTCTGACAAGATGAAATCT
CCTTGTGTATCCTTTCCGCATCCTTATCCATGCATGTGTTGATGGACGTGTGGGCTGCTCCCAT
AATGTACCTGTTCTGAGTAGTGTTTCAATAAACATCAGTTTGCAGACTTCTCAGATGATCAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_077753	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH03858	(Get FASTA)	NCBI Sequence Viewer
	BAB23788	(Get FASTA)	NCBI Sequence Viewer
	BAB27609	(Get FASTA)	NCBI Sequence Viewer
	BAB32865	(Get FASTA)	NCBI Sequence Viewer
	BAE39421	(Get FASTA)	NCBI Sequence Viewer
	EDL30955	(Get FASTA)	NCBI Sequence Viewer
	EDL30956	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000061092
	ENSMUSP00000061092.8
GenBank Protein	Q9CQ65	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_077753 ⟸ NM_024433

- UniProtKB:

Q3TJS4 (UniProtKB/Swiss-Prot), Q9CQ65 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQ
HTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGS
HCSARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGAD
VVNMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIP
QIGSMEWSETLRNLKNMAQFSVLPPRH

hide sequence

Ensembl Acc Id:

ENSMUSP00000061092 ⟸ ENSMUST00000058030

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CQ65-F1-model_v2	AlphaFold	Q9CQ65	1-283	view protein structure

Promoters

RGD ID:

6835710

Promoter ID:

MM_KWN:38369

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6

Transcripts:

OTTMUST00000017624

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	4	88,783,056 - 88,783,556 (+)	MPROMDB

RGD ID:

6883824

Promoter ID:

EPDNEW_M5363

Type:

initiation region

Name:

Mtap_1

Description:

Mus musculus methylthioadenosine phosphorylase , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	4	89,137,406 - 89,137,466	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1914152	AgrOrtholog
Ensembl Genes	ENSMUSG00000062937	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000058030	ENTREZGENE
	ENSMUST00000058030.10	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1580	UniProtKB/Swiss-Prot
InterPro	MTAP	UniProtKB/Swiss-Prot
	Nucleoside_phosphorylase_d	UniProtKB/Swiss-Prot
	Nucleoside_phosphorylase_sf	UniProtKB/Swiss-Prot
	Purine_phosphorylase-2_CS	UniProtKB/Swiss-Prot
KEGG Report	mmu:66902	UniProtKB/Swiss-Prot
MGD	MGI:1914152	ENTREZGENE
NCBI Gene	66902	ENTREZGENE
PANTHER	PTHR42679	UniProtKB/Swiss-Prot
	S-METHYL-5'-THIOADENOSINE PHOSPHORYLASE	UniProtKB/Swiss-Prot
Pfam	PNP_UDP_1	UniProtKB/Swiss-Prot
PhenoGen	Mtap	PhenoGen
PROSITE	PNP_MTAP_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF53167	UniProtKB/Swiss-Prot
UniProt	MTAP_MOUSE	UniProtKB/Swiss-Prot
	Q3TJS4	ENTREZGENE
	Q9CQ65	ENTREZGENE
UniProt Secondary	Q3TJS4	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype