Il36a (interleukin 36A) - Rat Genome Database

Name: Il36a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Il36a (interleukin 36A) Mus musculus

Analyze

Symbol:

Il36a

Name:

interleukin 36A

RGD ID:

1315733

MGI Page

MGI

Description:

Enables cytokine activity. Acts upstream of or within positive regulation of interleukin-6 production and signal transduction. Located in extracellular space. Orthologous to human IL36A (interleukin 36 alpha).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Fi; Fil; Fil1; FIL1 epsilon; Fil1epsilon; If36a; IL-1; IL-1 epsilon; IL-1F6; IL-1H1; Il1f6; Il1f9; IL1RP2; interleukin 1 family, member 6 (epsilon); interleukin 1 family, member 9; interleukin-1 epsilon; interleukin-1 family member 6; interleukin-1 homolog 1; interleukin-36 alpha; MGC151479; MGC151481

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IL36A (interleukin 36 alpha)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Il36a (interleukin 36, alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IL36A (interleukin 36 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Il36a (interleukin 36 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IL36A (interleukin 36 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IL36G (interleukin 36 gamma)	HGNC	OrthoDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Il36a (interleukin 36, alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IL36A (interleukin 36 alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	il1fma (interleukin-1 family member A)	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	24,105,429 - 24,115,713 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	24,105,430 - 24,115,714 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	24,215,417 - 24,225,701 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	24,215,418 - 24,225,702 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	24,070,937 - 24,081,221 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	24,037,426 - 24,047,710 (+)	NCBI		MGSCv36	mm8
Celera	2	23,934,862 - 23,945,148 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	16.26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

endometriosis (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4-hydroxynon-2-enal (EXP)

aflatoxin B1 (ISO)

aldrin (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (EXP)

arsenous acid (ISO)

benzalkonium chloride (EXP)

benzene (EXP)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

CGP 52608 (ISO)

chloroethene (EXP)

cisplatin (EXP)

diarsenic trioxide (ISO)

ferulic acid (EXP)

imiquimod (EXP)

lipopolysaccharide (ISO)

neoechinulin A (EXP)

paraquat (EXP)

pirinixic acid (ISO)

progesterone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (EXP,ISO)

sterigmatocystin (EXP)

testosterone (EXP)

titanium dioxide (EXP)

TMC-120A (EXP)

Tributyltin oxide (EXP)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to lipopolysaccharide (IBA)

cytokine-mediated signaling pathway (IBA)

immune response (IEA)

immune system process (IEA)

inflammatory response (TAS)

inflammatory response to antigenic stimulus (IBA)

innate immune response (IEA)

positive regulation of cytokine production (IDA)

positive regulation of gene expression (IBA)

positive regulation of interleukin-6 production (IGI)

Cellular Component

cytoplasm (IEA)

extracellular region (IEA)

extracellular space (IBA,IDA)

Molecular Function

cytokine activity (IBA,IGI)

interleukin-1 receptor binding (ISS)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal cytokine level (IAGP)

decreased physiological sensitivity to xenobiotic (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10349636	PMID:10625660	PMID:10744718	PMID:11042159	PMID:11076861	PMID:11466363	PMID:11991723	PMID:12477932	PMID:16141072	PMID:16141073	PMID:16896013	PMID:19571816
PMID:19717513	PMID:20101239	PMID:20833839	PMID:21242515	PMID:21860022	PMID:21873635	PMID:21965679	PMID:23029241	PMID:24829417	PMID:26066982	PMID:26203636	PMID:26438362
PMID:26813344	PMID:28057979	PMID:28724920	PMID:29109726	PMID:29279353	PMID:29794016	PMID:30352688	PMID:31068441	PMID:31884525	PMID:31982702	PMID:32488871	PMID:33645549
PMID:34555640	PMID:34686582	PMID:34697411	PMID:38412100

Genomics

Comparative Map Data

Il36a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	24,105,429 - 24,115,713 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	24,105,430 - 24,115,714 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	24,215,417 - 24,225,701 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	24,215,418 - 24,225,702 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	24,070,937 - 24,081,221 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	24,037,426 - 24,047,710 (+)	NCBI		MGSCv36	mm8
Celera	2	23,934,862 - 23,945,148 (+)	NCBI		Celera
Cytogenetic Map	2	A3	NCBI
cM Map	2	16.26	NCBI

IL36A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	113,005,459 - 113,011,072 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	113,005,459 - 113,008,044 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	113,763,036 - 113,765,621 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	113,479,920 - 113,482,092 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	113,479,679 - 113,481,852	NCBI
Celera	2	107,148,610 - 107,150,782 (+)	NCBI		Celera
Cytogenetic Map	2	q14.1	NCBI
HuRef	2	106,218,002 - 106,220,174 (+)	NCBI		HuRef
CHM1_1	2	113,767,604 - 113,769,776 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	113,431,988 - 113,437,599 (+)	NCBI		T2T-CHM13v2.0

Il36a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	27,395,146 - 27,399,695 (+)	NCBI		GRCr8
mRatBN7.2	3	6,996,851 - 7,001,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	6,996,851 - 7,001,400 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	10,091,850 - 10,096,462 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	18,678,075 - 18,682,687 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	16,867,882 - 16,872,494 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	1,330,790 - 1,335,811 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	1,331,226 - 1,335,775 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	1,323,993 - 1,328,542 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	2,482,480 - 2,487,029 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	2,473,610 - 2,485,996 (+)	NCBI
Celera	3	1,834,196 - 1,838,742 (+)	NCBI		Celera
Cytogenetic Map	3	p13	NCBI

IL36A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	15,143,627 - 15,157,101 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	15,146,393 - 15,151,862 (-)	NCBI		NHGRI_mPanPan1

Il36a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	82,474,970 - 82,476,974 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936783	1,369,537 - 1,371,458 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936783	1,369,454 - 1,371,458 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IL36A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	16,017,847 - 16,030,680 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	16,028,002 - 16,030,097 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	3,651,138 - 3,653,829 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Il36a
244 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	238
Count of miRNA genes:	143
Interacting mature miRNAs:	154
Transcripts:	ENSMUST00000028361, ENSMUST00000144442
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4141836	Tgq11_m	triglyceride QTL 11 (mouse)			Not determined			1	25324559	Mouse
4142333	Tgq10_m	triglyceride QTL 10 (mouse)			Not determined			1	25324559	Mouse
1301838	Sluc16_m	susceptibility to lung cancer 16 (mouse)			Not determined		2	1	26529589	Mouse
12904743	Carcdq3_m	cardiac collagen deposition QTL 3 (mouse)					2	3234940	28179150	Mouse
1301769	Orgwq2_m	organ weight QTL 2 (mouse)			Not determined		2	3887126	93421651	Mouse
1301980	Fcsa5_m	femoral cross-sectional area 5 (mouse)			Not determined		2	7679115	41679261	Mouse
1301790	Pcfm1_m	periosteal circumference and femur length 1 (mouse)			Not determined		2	8236296	42236396	Mouse
10043876	Adip22_m	adiposity 22 (mouse)			Not determined		2	8308051	42308240	Mouse
1300624	Insq7_m	insulin QTL 7 (mouse)			Not determined		2	9384446	43384575	Mouse
10755513	Amzn4_m	anatomical modifier of Zfp423 4 (mouse)					2	9384446	43384575	Mouse
12903993	Opfaq1_m	open field activity QTL 1 (mouse)					2	9676691	27022642	Mouse
8552707	Cia23_m	collagen induced arthritis QTL 23 (mouse)			Not determined		2	12129537	66556453	Mouse
1301641	Sbmd2_m	spinal bone mineral density 2 (mouse)			Not determined		2	14214567	48214713	Mouse
1357881	Estoq1_m	embryo survival total QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357454	Kidq1_m	kidney weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357436	Splq1_m	spleen weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
39128209	Lwq14_m	liver weight QTL 14 (mouse)					2	20897778	118894840	Mouse
1558899	Egq1_m	early growth QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1558966	W10q9_m	weight 10 weeks QTL 9 (mouse)			Not determined		2	20897778	118894840	Mouse
1558915	W3q1_m	weight 3 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1558738	W6q1_m	weight 6 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357681	Hrtq1_m	heart weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1301376	Etohc1_m	ethanol consumption 1 (mouse)			Not determined		2	21129725	55129871	Mouse
4141708	Pbwg1.2_m	postnatal body weight growth 1.2 (mouse)			Not determined			21129725	55129871	Mouse
13463470	Tubisq1_m	tubulointerstitial injury severity, QTL 1 (mouse)					2	23689145	57689269	Mouse

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF200493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF206697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK004061	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK224928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK224929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK224931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK224932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL732430	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC117104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KM205447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KM205448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000028361 ⟹ ENSMUSP00000028361

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	24,105,430 - 24,115,714 (+)	Ensembl
GRCm38.p6 Ensembl	2	24,215,418 - 24,225,702 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000144442

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	24,105,517 - 24,115,537 (+)	Ensembl
GRCm38.p6 Ensembl	2	24,215,505 - 24,225,525 (+)	Ensembl

RefSeq Acc Id:

NM_019450 ⟹ NP_062323

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	24,105,429 - 24,115,713 (+)	NCBI
GRCm38	2	24,215,417 - 24,225,701 (+)	ENTREZGENE
MGSCv37	2	24,070,937 - 24,081,221 (+)	RGD
Celera	2	23,934,862 - 23,945,148 (+)	RGD
cM Map	2		ENTREZGENE

Sequence:

show sequence

TAACCTCCTCTTTTCGTGTTGTGGATAAAAGGCTTGGACCTTAGTAGAGCTTGTCAGAGAAGCT
GAGCACAGTAGTGGGTGTAGTTCTGTAGTGTGCAGACACATTCCTATTCAATCAGGGTCAATCT
GCAGATTGGCAGCTCAGAAACAACATCACCATAATGAATAAGGAGAAAGAACTAAGAGCAGCAT
CACCTTCGCTTAGACATGTTCAGGATCTTAGTAGTCGTGTGTGGATCCTGCAGAACAATATCCT
CACTGCAGTCCCAAGGAAAGAGCAAACAGTTCCAGTCACTATTACCTTGCTCCCATGCCAATAT
CTGGACACTCTTGAGACGAACAGGGGGGATCCCACGTACATGGGAGTGCAAAGGCCGATGAGCT
GCCTGTTCTGCACAAAGGATGGGGAGCAGCCTGTGCTACAGCTTGGGGAAGGGAACATAATGGA
AATGTACAACAAAAAGGAACCTGTAAAAGCCTCTCTCTTCTATCACAAGAAGAGTGGTACAACC
TCTACATTTGAGTCTGCAGCCTTCCCTGGTTGGTTCATCGCTGTCTGCTCTAAAGGGAGCTGCC
CACTCATTCTGACCCAAGAACTGGGGGAAATCTTCATCACTGACTTCGAGATGATTGTGGTACA
TTAAGGTTTTTAGACACATTGCTCTGTGGCACTCTCTCAAGATTTCTTGGATTCTAACAAGAAG
CAATCAAAGACACCCCTAACAAAATGGAAGACTGAAAAGAAAGCTGAGCCCTCCCTGGGCTGTT
TTTCCTTGGTGGTGAATCAGATGCAGAACATCTTACCATGTTTTCATCCAAAGCATTTACTGTT
GGTTTTTACAAGGAGTGAATTTTTTAAAATAAAATCATTTATCTCATTTGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_062323	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF69249	(Get FASTA)	NCBI Sequence Viewer
	AAG35671	(Get FASTA)	NCBI Sequence Viewer
	AAI17103	(Get FASTA)	NCBI Sequence Viewer
	AAI17105	(Get FASTA)	NCBI Sequence Viewer
	AKA62187	(Get FASTA)	NCBI Sequence Viewer
	AKA62188	(Get FASTA)	NCBI Sequence Viewer
	BAB23147	(Get FASTA)	NCBI Sequence Viewer
	EDL08163	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000028361
	ENSMUSP00000028361.5
GenBank Protein	Q9JLA2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062323 ⟸ NM_019450
- UniProtKB:	Q9JLA2 (UniProtKB/Swiss-Prot), Q149U6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDP TYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGW FIAVCSKGSCPLILTQELGEIFITDFEMIVVH hide sequence

RefSeq Acc Id:

ENSMUSP00000028361 ⟸ ENSMUST00000028361

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9JLA2-F1-model_v2	AlphaFold	Q9JLA2	1-160	view protein structure

Promoters

RGD ID:

6876510

Promoter ID:

EPDNEW_M1705

Type:

single initiation site

Name:

Il1f6_1

Description:

Mus musculus interleukin 1 family, member 6 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	24,215,472 - 24,215,532	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1859324	AgrOrtholog
Ensembl Genes	ENSMUSG00000026984	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000028361	ENTREZGENE
	ENSMUST00000028361.5	UniProtKB/Swiss-Prot
Gene3D-CATH	2.80.10.50	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	IL-1_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IL-1RA/IL-36	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IL1/FGF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:54448	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1859324	ENTREZGENE
NCBI Gene	54448	ENTREZGENE
PANTHER	PTHR10078	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10078:SF25	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	IL1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Il36a	PhenoGen
PRINTS	INTRLEUKIN1X	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	IL1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50353	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2SSZ4_MOUSE	UniProtKB/TrEMBL
	IL36A_MOUSE	UniProtKB/Swiss-Prot
	Q149U6	ENTREZGENE, UniProtKB/TrEMBL
	Q9JLA2	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-12-28	Il36a	interleukin 36A	Il1f6	interleukin 1 family, member 6	Symbol and/or name updated	27372883	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype