Trex1 (three prime repair exonuclease 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Trex1 (three prime repair exonuclease 1) Rattus norvegicus

Analyze

Symbol:

Trex1

Name:

three prime repair exonuclease 1

RGD ID:

1311998

Description:

Predicted to enable several functions, including DNA binding activity; WW domain binding activity; and mismatch repair complex binding activity. Predicted to be involved in DNA metabolic process and negative regulation of innate immune response. Predicted to act upstream of or within several processes, including DNA metabolic process; circulatory system development; and defense response to other organism. Predicted to be located in cytosol; endoplasmic reticulum membrane; and nuclear replication fork. Predicted to be part of oligosaccharyltransferase complex and protein-DNA complex. Predicted to be active in cytoplasm. Human ortholog(s) of this gene implicated in Aicardi-Goutieres syndrome; Chilblain lupus; retinal vasculopathy with cerebral leukodystrophy; and systemic lupus erythematosus. Orthologous to human TREX1 (three prime repair exonuclease 1); PARTICIPATES IN DNA replication pathway; G2/M DNA damage checkpoint pathway; INTERACTS WITH (+)-pilocarpine; 1-chloro-2,4-dinitrobenzene; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC301014; MGC109019; RGD1309596; three-prime repair exonuclease 1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TREX1 (three prime repair exonuclease 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Trex1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Trex1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TREX1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TREX1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trex1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TREX1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TREX1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trex1 (three prime repair exonuclease 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	EPS8L1 (EPS8 like 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Trex1 (three prime repair exonuclease 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TREX1 (three prime repair exonuclease 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch1073-385f13.3	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Danio rerio (zebrafish):	si:ch1073-296i8.2	Alliance	DIOPT (Ensembl Compara\|InParanoid)
Drosophila melanogaster (fruit fly):	CG3165	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	W02F12.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	109,706,613 - 109,707,913 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	109,706,613 - 109,708,796 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	115,321,502 - 115,322,802 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	113,520,676 - 113,521,976 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	111,363,483 - 111,364,783 (-)	NCBI	Rnor_WKY
Rnor_6.0	8	117,796,127 - 117,797,427 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,796,128 - 117,797,427 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	117,147,872 - 117,149,172 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	114,071,508 - 114,072,509 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	114,092,776 - 114,106,801 (-)	NCBI
Celera	8	108,998,058 - 108,999,059 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aicardi-Goutieres syndrome (ISO)

Aicardi-Goutieres Syndrome 1 (ISO)

brain disease (ISO)

CADASIL (ISO)

Chilblain lupus (ISO)

Chilblain Lupus 1 (ISO)

cutaneous lupus erythematosus (ISS)

genetic disease (ISO)

Human Influenza (ISO)

Inflammation (ISO)

Progressive Microcephaly with Seizures and Cerebral and Cerebellar Atrophy (ISO)

retinal vasculopathy with cerebral leukodystrophy (ISO)

systemic lupus erythematosus (ISO)

Thrombotic Microangiopathies (ISO)

vascular dementia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

4-(ethoxymethylene)-2-phenyloxazol-5-one (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

amiodarone (ISO)

amphetamine (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

biphenyl-4-amine (ISO)

bisphenol A (EXP,ISO)

Brevetoxin B (ISO)

bromoacetate (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

carmustine (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cypermethrin (ISO)

diazinon (ISO)

dorsomorphin (ISO)

elemental selenium (ISO)

eticlopride(1+) (EXP)

flutamide (EXP)

folic acid (ISO)

fotemustine (ISO)

Genipin (ISO)

hydrogen peroxide (ISO)

imiquimod (ISO)

lipopolysaccharide (ISO)

mifepristone (EXP)

myristicin (ISO)

nimustine (ISO)

oxaliplatin (EXP)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

quinpirole (EXP)

rotenone (EXP)

SB 431542 (ISO)

selenium atom (ISO)

selenomethionine (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

succimer (ISO)

testosterone (ISO)

topotecan (EXP,ISO)

trimellitic anhydride (EXP)

valproic acid (ISO)

vanadyl sulfate (ISO)

vancomycin (ISO)

vincristine (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of immune response (ISO)

adaptive immune response (ISO)

apoptotic cell clearance (ISO)

atrial cardiac muscle tissue development (ISO)

blood vessel development (ISO)

CD86 biosynthetic process (ISO)

cellular response to gamma radiation (ISO)

cellular response to hydroxyurea (ISO)

cellular response to interferon-beta (ISO)

cellular response to organic substance (ISO)

cellular response to oxidative stress (ISO)

cellular response to reactive oxygen species (ISO)

cellular response to type I interferon (ISO)

cellular response to UV (ISO)

defense response to virus (ISO)

determination of adult lifespan (ISO)

DNA catabolic process (ISO)

DNA damage checkpoint signaling (ISO)

DNA damage response (ISO)

DNA duplex unwinding (ISO)

DNA metabolic process (ISO)

DNA modification (ISO)

DNA replication (ISO)

DNA synthesis involved in UV-damage excision repair (ISO)

establishment of protein localization (ISO)

generation of precursor metabolites and energy (ISO)

heart morphogenesis (ISO)

heart process (ISO)

immune complex formation (ISO)

immune response (ISO)

immune response in brain or nervous system (ISO)

inflammatory response (ISO)

inflammatory response to antigenic stimulus (ISO)

innate immune response (ISO)

kidney development (ISO)

lymphoid progenitor cell differentiation (ISO)

macrophage activation involved in immune response (ISO)

mitotic G1 DNA damage checkpoint signaling (ISO)

negative regulation of innate immune response (ISO)

negative regulation of type I interferon-mediated signaling pathway (ISO)

organ or tissue specific immune response (ISO)

protein stabilization (ISO)

regulation of catalytic activity (ISO)

regulation of cellular respiration (ISO)

regulation of fatty acid metabolic process (ISO)

regulation of gene expression (ISO)

regulation of glycolytic process (ISO)

regulation of immunoglobulin production (ISO)

regulation of inflammatory response (ISO)

regulation of innate immune response (ISO)

regulation of lipid biosynthetic process (ISO)

regulation of lysosome organization (ISO)

regulation of protein complex stability (ISO)

regulation of T cell activation (ISO)

regulation of tumor necrosis factor production (ISO)

regulation of type I interferon production (ISO)

response to UV (ISO)

retrotransposition (ISO)

T cell antigen processing and presentation (ISO)

type I interferon-mediated signaling pathway (ISO)

Cellular Component

cytoplasm (IBA,ISO)

cytosol (ISO)

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (ISO)

nuclear replication fork (ISO)

nucleus (ISO)

oligosaccharyltransferase complex (ISO)

protein-DNA complex (ISO)

Molecular Function

3'-5' exonuclease activity (ISO)

3'-5'-DNA exonuclease activity (IBA,ISO)

adenyl deoxyribonucleotide binding (ISO)

DNA binding (ISO)

DNA binding, bending (ISO)

double-stranded DNA 3'-5' DNA exonuclease activity (ISO)

double-stranded DNA binding (ISO)

identical protein binding (ISO)

magnesium ion binding (ISO)

MutLalpha complex binding (ISO)

MutSalpha complex binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

single-stranded DNA binding (ISO)

WW domain binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

DNA replication pathway (ISO)

G2/M DNA damage checkpoint pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ATR and ATRIP: partners in checkpoint signaling.	Cortez D, etal., Science. 2001 Nov 23;294(5547):1713-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10391904	PMID:11279105	PMID:12477932	PMID:15254239	PMID:16713580	PMID:17293595	PMID:17355961	PMID:18045533	PMID:18724932	PMID:19158679	PMID:19923437	PMID:20511593
PMID:20871604	PMID:23160154	PMID:23993650	PMID:24154727	PMID:24205360	PMID:24218451	PMID:25848017	PMID:26320659	PMID:26371324	PMID:28069950	PMID:28351661	PMID:28835460

Genomics

Comparative Map Data

Trex1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	109,706,613 - 109,707,913 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	109,706,613 - 109,708,796 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	115,321,502 - 115,322,802 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	113,520,676 - 113,521,976 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	111,363,483 - 111,364,783 (-)	NCBI	Rnor_WKY
Rnor_6.0	8	117,796,127 - 117,797,427 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,796,128 - 117,797,427 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	117,147,872 - 117,149,172 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	114,071,508 - 114,072,509 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	114,092,776 - 114,106,801 (-)	NCBI
Celera	8	108,998,058 - 108,999,059 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

TREX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	48,465,830 - 48,467,645 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	48,465,811 - 48,467,645 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	48,507,229 - 48,509,044 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	48,482,233 - 48,484,048 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	48,463,221 - 48,482,058	NCBI
Celera	3	48,458,088 - 48,459,903 (+)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	48,560,949 - 48,563,074 (+)	NCBI		HuRef
CHM1_1	3	48,459,219 - 48,461,344 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	48,493,835 - 48,495,650 (+)	NCBI		T2T-CHM13v2.0

Trex1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	108,887,000 - 108,888,791 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	108,887,001 - 108,888,802 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	109,057,932 - 109,059,723 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	109,057,933 - 109,059,734 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	108,960,446 - 108,962,237 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	108,915,338 - 108,917,129 (-)	NCBI		MGSCv36	mm8
Celera	9	108,616,714 - 108,618,505 (-)	NCBI		Celera
Cytogenetic Map	9	F2	NCBI

Trex1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955532	533,877 - 535,767 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955532	533,877 - 535,767 (+)	NCBI	ChiLan1.0	ChiLan1.0

TREX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	3	48,445,488 - 48,447,908 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	48,387,762 - 48,389,693 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	49,469,406 - 49,471,371 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	49,470,222 - 49,471,331 (+)	Ensembl	panpan1.1		panPan2

TREX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	40,624,845 - 40,626,840 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	40,624,891 - 40,626,906 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	40,542,323 - 40,544,332 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	41,110,233 - 41,112,242 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	41,107,235 - 41,112,226 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	40,347,667 - 40,349,676 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	40,752,252 - 40,754,261 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	41,032,948 - 41,034,957 (-)	NCBI		UU_Cfam_GSD_1.0

Trex1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	63,503,993 - 63,505,949 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	264,468 - 266,422 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936529	264,535 - 266,451 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TREX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	31,179,291 - 31,180,747 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	31,177,604 - 31,180,764 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	34,561,987 - 34,563,735 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TREX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	9,869,502 - 9,871,659 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666041	157,219,548 - 157,221,411 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trex1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	2,431,999 - 2,432,959 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	2,431,270 - 2,433,010 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Trex1
3 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	45
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000033719
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088624	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	100149864	120994388	Rat

Markers in Region

AU041952

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,706,669 - 109,706,780 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,796,184 - 117,796,294	NCBI	Rnor6.0
Rnor_5.0	8	117,147,929 - 117,148,039	UniSTS	Rnor5.0
RGSC_v3.4	8	114,071,565 - 114,071,675	UniSTS	RGSC3.4
Celera	8	108,998,115 - 108,998,225	UniSTS
Cytogenetic Map	8	q32	UniSTS

RH129942

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,706,643 - 109,706,834 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,796,158 - 117,796,348	NCBI	Rnor6.0
Rnor_5.0	8	117,147,903 - 117,148,093	UniSTS	Rnor5.0
RGSC_v3.4	8	114,071,539 - 114,071,729	UniSTS	RGSC3.4
Celera	8	108,998,089 - 108,998,279	UniSTS
RH 3.4 Map	8	1115.59	UniSTS
Cytogenetic Map	8	q32	UniSTS

RH131155

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,706,148 - 109,706,328 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,795,663 - 117,795,842	NCBI	Rnor6.0
Rnor_5.0	8	117,147,408 - 117,147,587	UniSTS	Rnor5.0
RGSC_v3.4	8	114,071,044 - 114,071,223	UniSTS	RGSC3.4
Celera	8	108,997,594 - 108,997,773	UniSTS
RH 3.4 Map	8	1114.9	UniSTS
RH 3.4 Map	8	1114.2	UniSTS
Cytogenetic Map	8	q32	UniSTS

BE101097

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,708,544 - 109,709,013 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,798,059 - 117,798,527	NCBI	Rnor6.0
Rnor_5.0	8	117,149,804 - 117,150,272	UniSTS	Rnor5.0
RGSC_v3.4	8	114,073,426 - 114,073,894	UniSTS	RGSC3.4
Celera	8	108,999,838 - 109,000,306	UniSTS
RH 3.4 Map	8	1115.19	UniSTS
Cytogenetic Map	8	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	22	16	6	16	6	1	4	57	28	29	10	1
Low		21	41	35	3	35	7	7	17	7	12	1	7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000033719 ⟹ ENSRNOP00000034541

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	109,706,613 - 109,708,796 (-)	Ensembl
Rnor_6.0 Ensembl	8	117,796,128 - 117,797,427 (-)	Ensembl

RefSeq Acc Id:

NM_001024989 ⟹ NP_001020160

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	109,706,613 - 109,707,913 (-)	NCBI
Rnor_6.0	8	117,796,127 - 117,797,427 (-)	NCBI
Rnor_5.0	8	117,147,872 - 117,149,172 (-)	NCBI
RGSC_v3.4	8	114,071,508 - 114,072,509 (-)	RGD
Celera	8	108,998,058 - 108,999,059 (-)	RGD

Sequence:

show sequence

CTTGTTGCCTGCTTATCGGCTCAGCATGGGCTCACAGGCCCTGCCCCACGGTCACATGCAGACC
CTCATCTTCTTAGACCTGGAAGCCACTGGCCTGCCTTACTCTCAGCCCAAAATCACAGAGCTGT
GCCTGCTGGCTGTCCACAGACATGCCCTGGAGAACTCCTCCATGTCTGAGGGGCAGCCACCTCC
GGTGCCCAAACCACCCCGTGTGGTGGACAAGCTCTCTCTCTGCATTGCTCCAGGGAAACCCTGC
AGTTCTGGGGCCAGTGAGATCACAGGTCTGACCACAGCTGGGCTGGAAGCACACGGGCGTCAAC
GCTTCAATGACAACCTGGCCACCCTGCTCCAAGTCTTCCTGCAGCGCCAGCCACAGCCCTGCTG
CCTTGTGGCCCACAACGGTGACCGCTACGACTTTCCTCTGCTCCAGGCAGAGCTTGCTTCGCTG
AGCGTTATCAGTCCTCTGGACGGTACCTTCTGTGTGGATAGCATCGCTGCCCTGAAGACCTTGG
AGCAAGCCAGCAGCCCCTCAGAGCATGGTCCGAGGAAAAGCTATAGCCTGGGTAGTATCTACAC
CCGCCTGTACGGGCAAGCACCAACAGACTCACACACTGCTGAAGGCGACGTTCTAGCCCTGCTC
AGCATCTGTCAGTGGAAGCCACAGGCCCTACTGCAGTGGGTGGACAAACACGCCCGGCCCTTTA
GCACCATCAAGCCCATGTATGGCATGGCAGCTACTACTGGAACGGCCAGCCCAAGGCTGTGTGC
TGCCACAACCTCCTCACCCCTGGCCACAGCCAACTTAAGTCCCAGCAATGGCAGGAGCAGGGGC
AAGCGACCTACGAGTCCTCCTCCAGAGAACGTCCCAGAAGCCCCATCACGGGAGGGGCTGCTGG
CCCCACTGGGCCTGCTGACCTTCCTGACCTTGGCAATAGCCGTTCTGTATGGAATCTTCCTGGC
CTCACCTGGGCAGTAAGTCAAGAGGGAAGATATGATTAATAAAGACTACCATAGCACTGAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020160	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91242	(Get FASTA)	NCBI Sequence Viewer
	EDL77115	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001020160 ⟸ NM_001024989

- UniProtKB:

Q5BK16 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGSQALPHGHMQTLIFLDLEATGLPYSQPKITELCLLAVHRHALENSSMSEGQPPPVPKPPRVV
DKLSLCIAPGKPCSSGASEITGLTTAGLEAHGRQRFNDNLATLLQVFLQRQPQPCCLVAHNGDR
YDFPLLQAELASLSVISPLDGTFCVDSIAALKTLEQASSPSEHGPRKSYSLGSIYTRLYGQAPT
DSHTAEGDVLALLSICQWKPQALLQWVDKHARPFSTIKPMYGMAATTGTASPRLCAATTSSPLA
TANLSPSNGRSRGKRPTSPPPENVPEAPSREGLLAPLGLLTFLTLAIAVLYGIFLASPGQ

hide sequence

RefSeq Acc Id:

ENSRNOP00000034541 ⟸ ENSRNOT00000033719

Protein Domains

Exonuclease

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK16-F1-model_v2	AlphaFold	Q5BK16	1-316	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696320

Promoter ID:

EPDNEW_R6845

Type:

initiation region

Name:

Trex1_1

Description:

three prime repair exonuclease 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	117,797,445 - 117,797,505	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311998	AgrOrtholog
BioCyc Gene	G2FUF-29095	BioCyc
Ensembl Genes	ENSRNOG00000022540	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000034541	ENTREZGENE
	ENSRNOP00000034541.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000033719	ENTREZGENE
	ENSRNOT00000033719.6	UniProtKB/TrEMBL
Gene3D-CATH	3.30.420.10	UniProtKB/TrEMBL
InterPro	Exonuclease_RNaseT/DNA_pol3	UniProtKB/TrEMBL
	PolynucTfrase_RNaseH_fold	UniProtKB/TrEMBL
	RNaseH_sf	UniProtKB/TrEMBL
	TREX1/2	UniProtKB/TrEMBL
KEGG Report	rno:100049583	UniProtKB/TrEMBL
NCBI Gene	100049583	ENTREZGENE
PANTHER	PTHR13058	UniProtKB/TrEMBL
	THREE-PRIME REPAIR EXONUCLEASE 1	UniProtKB/TrEMBL
PhenoGen	Trex1	PhenoGen
SMART	EXOIII	UniProtKB/TrEMBL
Superfamily-SCOP	RNaseH_fold	UniProtKB/TrEMBL
UniProt	Q5BK16	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Trex1	three prime repair exonuclease 1	Trex1_predicted	three prime repair exonuclease 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Trex1_predicted	three prime repair exonuclease 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations