Advanced Search (OLGA)

Gene: Trps1 (transcriptional repressor GATA binding 1) Rattus norvegicus

Analyze

Symbol:

Trps1

Name:

transcriptional repressor GATA binding 1

RGD ID:

1311883

Description:

Predicted to enable DNA-binding transcription repressor activity, RNA polymerase II-specific; RNA polymerase II transcription regulatory region sequence-specific DNA binding activity; and protein domain specific binding activity. Predicted to be involved in several processes, including hair follicle development; negative regulation of transcription by RNA polymerase II; and regulation of chondrocyte differentiation. Predicted to act upstream of or within several processes, including cell surface receptor protein serine/threonine kinase signaling pathway; chondrocyte differentiation; and positive regulation of extrinsic apoptotic signaling pathway via death domain receptors. Predicted to be located in chromatin and nucleoplasm. Predicted to be part of protein-containing complex. Human ortholog(s) of this gene implicated in osteochondrodysplasia; trichorhinophalangeal syndrome type I; and trichorhinophalangeal syndrome type III. Orthologous to human TRPS1 (transcriptional repressor GATA binding 1); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; 3,4-methylenedioxymethamphetamine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC299897; trichorhinophalangeal syndrome I; trichorhinophalangeal syndrome I (human); trichorhinophalangeal syndrome I homolog; trichorhinophalangeal syndrome I homolog (human); zinc finger transcription factor Trps1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	83,806,121 - 84,032,609 (-)	NCBI		GRCr8
mRatBN7.2	7	81,916,668 - 82,142,733 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	81,921,601 - 82,141,905 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	83,803,208 - 84,022,882 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	86,005,758 - 86,225,442 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	85,848,280 - 86,067,966 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	90,085,895 - 90,320,430 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	90,090,828 - 90,318,221 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	90,113,508 - 90,343,325 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	86,855,378 - 87,076,668 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	86,876,430 - 87,097,949 (-)	NCBI
Celera	7	78,810,727 - 79,029,498 (-)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	osteochondrodysplasia		ISO	RGD:1323571	1599670	trichorhinophalangeal syndrome type I, OMIM:190350	RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	brachydactyly		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Brachydactyly	ClinVar	PMID:11112658\|PMID:18946009\|PMID:24502542\|PMID:25741868\|PMID:25792522\|PMID:28468609\|PMID:28492532\|PMID:30541476
Trps1	Rat	CAKUT		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Congenital anomalies of kidney and urinary tract	ClinVar	PMID:11112658\|PMID:11950061\|PMID:18946009\|PMID:24502542\|PMID:25792522\|PMID:28492532\|PMID:30143558\|PMID:30541476
Trps1	Rat	Craniosynostosis Syndrome, Autosomal Recessive		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Craniosynostosis syndrome	ClinVar
Trps1	Rat	genetic disease		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:10615131\|PMID:11112658\|PMID:25741868\|PMID:25792522\|PMID:26113321\|PMID:28004029\|PMID:28492532\|PMID:30914275
Trps1	Rat	hereditary multiple exostoses		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Multiple congenital exostosis	ClinVar	PMID:28492532
Trps1	Rat	Metaphyseal Chondrodysplasia		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Metaphyseal chondrodysplasia	ClinVar	PMID:25741868\|PMID:25792522\|PMID:28426188\|PMID:28492532\|PMID:31502745
Trps1	Rat	microcephaly		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Microcephaly	ClinVar	PMID:25741868
Trps1	Rat	Trichorhinophalangeal Syndrome		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal syndrome \| ClinVar Annotator: match by term: Trichorhinophalangeal syndrome more ...	ClinVar	PMID:25333908\|PMID:25741868\|PMID:28492532\|PMID:29095814
Trps1	Rat	trichorhinophalangeal syndrome type I		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal Syndrome Type I \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:10615131\|PMID:11112658\|PMID:11359471\|PMID:11807863\|PMID:11950061\|PMID:14560312\|PMID:17854380\|PMID:18946009\|PMID:19694891\|PMID:22964620\|PMID:23451857\|PMID:23621477\|PMID:24357341\|PMID:24502542\|PMID:25741868\|PMID:25792522\|PMID:26380986\|PMID:27826100\|PMID:28050602\|PMID:28170084\|PMID:28244134\|PMID:28426188\|PMID:28468609\|PMID:28492532\|PMID:30143558\|PMID:30541476\|PMID:30914275\|PMID:31502745\|PMID:31884116
Trps1	Rat	trichorhinophalangeal syndrome type II		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Langer-Giedion syndrome \| ClinVar Annotator: match by term: Trichorhinophalangeal syndrome more ...	ClinVar	PMID:11112658\|PMID:22964620\|PMID:23451857\|PMID:25741868\|PMID:25792522\|PMID:28050602\|PMID:28492532
Trps1	Rat	trichorhinophalangeal syndrome type III		ISO	RGD:1323571	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal syndrome, type III	ClinVar	PMID:10615131\|PMID:11112658\|PMID:11807863\|PMID:11950061\|PMID:14560312\|PMID:15367484\|PMID:16199547\|PMID:17576681\|PMID:17854380\|PMID:18946009\|PMID:19694891\|PMID:20394624\|PMID:21850686\|PMID:22964620\|PMID:23451857\|PMID:23572024\|PMID:23621477\|PMID:23691375\|PMID:24357341\|PMID:24502542\|PMID:24945424\|PMID:25741868\|PMID:25792522\|PMID:26113321\|PMID:27826100\|PMID:28050602\|PMID:28170084\|PMID:28244134\|PMID:28426188\|PMID:28468609\|PMID:28492532\|PMID:29095814\|PMID:29499646\|PMID:30143558\|PMID:30458885\|PMID:30541476\|PMID:30914275\|PMID:31502745\|PMID:31884116\|PMID:32844440\|PMID:33073934\|PMID:9536098

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	Animal Mammary Neoplasms		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16316942
Trps1	Rat	bone development disease		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19759027
Trps1	Rat	carcinoma		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16316942
Trps1	Rat	Craniofacial Abnormalities		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:11708946\|PMID:19759027
Trps1	Rat	Experimental Mammary Neoplasms		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16316942
Trps1	Rat	trichorhinophalangeal syndrome type I		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD
Trps1	Rat	trichorhinophalangeal syndrome type II		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:11708946
Trps1	Rat	trichorhinophalangeal syndrome type III		ISO	RGD:1323571	11554173	CTD Direct Evidence: marker/mechanism	CTD

Imported Disease Annotations - MGI

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	trichorhinophalangeal syndrome type I		ISS	RGD:1323572	13592920	OMIM:190350	MouseDO

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	trichorhinophalangeal syndrome type I		ISO	RGD:1323571	7240710		OMIM
Trps1	Rat	trichorhinophalangeal syndrome type III		ISO	RGD:1323571	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	1,2-dichloroethane	increases expression	ISO	RGD:1323572	6480464	ethylene dichloride results in increased expression of TRPS1 mRNA	CTD	PMID:28960355
Trps1	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	decreases expression	ISO	RGD:1323571	6480464	Metribolone results in decreased expression of TRPS1 mRNA	CTD	PMID:19759027
Trps1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1323572	6480464	Tetrachlorodibenzodioxin affects the expression of TRPS1 mRNA	CTD	PMID:21570461\|PMID:24058054
Trps1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1323572	6480464	Tetrachlorodibenzodioxin results in increased expression of TRPS1 mRNA	CTD	PMID:21354282\|PMID:37172768
Trps1	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of TRPS1 mRNA	CTD	PMID:32109520
Trps1	Rat	3,4-methylenedioxymethamphetamine	decreases expression	EXP		6480464	N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of TRPS1 mRNA	CTD	PMID:30071829
Trps1	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1323572	6480464	Fenretinide results in decreased expression of TRPS1 mRNA	CTD	PMID:28973697
Trps1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of TRPS1 mRNA	CTD	PMID:31881176
Trps1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1323571	6480464	Aflatoxin B1 results in decreased methylation of TRPS1 gene	CTD	PMID:27153756
Trps1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1323571	6480464	Tretinoin results in increased expression of TRPS1 mRNA	CTD	PMID:21934132
Trps1	Rat	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of TRPS1 mRNA	CTD	PMID:20488242
Trps1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TRPS1 mRNA	CTD	PMID:35163327
Trps1	Rat	amphotericin B	decreases expression	ISO	RGD:1323571	6480464	Amphotericin B analog results in decreased expression of TRPS1 mRNA	CTD	PMID:28534445
Trps1	Rat	aristolochic acid A	decreases expression	ISO	RGD:1323571	6480464	aristolochic acid I results in decreased expression of TRPS1 mRNA	CTD	PMID:33212167
Trps1	Rat	Aroclor 1254	decreases expression	ISO	RGD:1323572	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of TRPS1 mRNA	CTD	PMID:23650126
Trps1	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1323571	6480464	arsenite inhibits the reaction [G3BP1 protein binds to TRPS1 mRNA]	CTD	PMID:32406909
Trps1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1323571	6480464	Benzo(a)pyrene results in decreased expression of TRPS1 mRNA	CTD	PMID:20064835
Trps1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1323571	6480464	Benzo(a)pyrene results in increased methylation of TRPS1 3' UTR	CTD	PMID:27901495
Trps1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1323571	6480464	Benzo(a)pyrene affects the methylation of TRPS1 5' UTR	CTD	PMID:27901495
Trps1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1323571	6480464	Benzo(a)pyrene results in increased expression of TRPS1 mRNA	CTD	PMID:22316170
Trps1	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	EXP		6480464	[bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of TRPS1 more ...	CTD	PMID:23359474
Trps1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of TRPS1 more ...	CTD	PMID:23359474
Trps1	Rat	bisphenol A	increases expression	ISO	RGD:1323572	6480464	bisphenol A results in increased expression of TRPS1 mRNA	CTD	PMID:35479511
Trps1	Rat	bisphenol A	increases expression	ISO	RGD:1323571	6480464	bisphenol A results in increased expression of TRPS1 mRNA	CTD	PMID:29275510
Trps1	Rat	bisphenol A	affects methylation	ISO	RGD:1323572	6480464	bisphenol A affects the methylation of TRPS1 promoter	CTD	PMID:27334623
Trps1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TRPS1 mRNA	CTD	PMID:29097150
Trps1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TRPS1 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016\|PMID:34947998
Trps1	Rat	calciol	decreases expression	EXP		6480464	Cholecalciferol results in decreased expression of TRPS1 mRNA	CTD	PMID:19759027
Trps1	Rat	chloroprene	increases expression	EXP		6480464	Chloroprene results in increased expression of TRPS1 mRNA	CTD	PMID:23125180
Trps1	Rat	chlorpyrifos	decreases expression	ISO	RGD:1323572	6480464	Chlorpyrifos results in decreased expression of TRPS1 mRNA	CTD	PMID:37019170
Trps1	Rat	choline	multiple interactions	ISO	RGD:1323572	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Trps1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of TRPS1 mRNA	CTD	PMID:24386269
Trps1	Rat	coumarin	decreases phosphorylation	ISO	RGD:1323571	6480464	coumarin results in decreased phosphorylation of TRPS1 protein	CTD	PMID:35688186
Trps1	Rat	DDE	decreases expression	ISO	RGD:1323571	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of TRPS1 mRNA	CTD	PMID:38568856
Trps1	Rat	dexamethasone	decreases expression	ISO	RGD:1323571	6480464	Dexamethasone results in decreased expression of TRPS1 mRNA	CTD	PMID:25047013
Trps1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1323571	6480464	di-n-butylphosphoric acid affects the expression of TRPS1 mRNA	CTD	PMID:37042841
Trps1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of TRPS1 mRNA	CTD	PMID:24893172
Trps1	Rat	dibutyl phthalate	multiple interactions	EXP		6480464	[bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of TRPS1 more ...	CTD	PMID:23359474
Trps1	Rat	dichloromethane	increases expression	ISO	RGD:1323572	6480464	Methylene Chloride results in increased expression of TRPS1 mRNA	CTD	PMID:28392392
Trps1	Rat	diquat	decreases expression	ISO	RGD:1323572	6480464	Diquat results in decreased expression of TRPS1 mRNA	CTD	PMID:36851058
Trps1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Trps1	Rat	doxorubicin	multiple interactions	ISO	RGD:1323572	6480464	[Doxorubicin co-treated with Folic Acid] results in increased expression of TRPS1 mRNA	CTD	PMID:28608983
Trps1	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of TRPS1 mRNA	CTD	PMID:29391264
Trps1	Rat	entinostat	increases expression	ISO	RGD:1323571	6480464	entinostat results in increased expression of TRPS1 mRNA	CTD	PMID:26272509
Trps1	Rat	entinostat	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Trps1	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of TRPS1 mRNA	CTD	PMID:30307764
Trps1	Rat	folic acid	multiple interactions	ISO	RGD:1323572	6480464	[Doxorubicin co-treated with Folic Acid] results in increased expression of TRPS1 mRNA; [Methionine deficiency co-treated more ...	CTD	PMID:20938992\|PMID:28608983
Trps1	Rat	folic acid	decreases expression	ISO	RGD:1323572	6480464	Folic Acid results in decreased expression of TRPS1 mRNA	CTD	PMID:25629700
Trps1	Rat	formaldehyde	decreases expression	ISO	RGD:1323571	6480464	Formaldehyde results in decreased expression of TRPS1 mRNA	CTD	PMID:20655997
Trps1	Rat	FR900359	affects phosphorylation	ISO	RGD:1323571	6480464	FR900359 affects the phosphorylation of TRPS1 protein	CTD	PMID:37730182
Trps1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of TRPS1 mRNA	CTD	PMID:33387578
Trps1	Rat	geraniol	increases expression	ISO	RGD:1323571	6480464	geraniol results in increased expression of TRPS1 mRNA	CTD	PMID:27683099
Trps1	Rat	L-methionine	multiple interactions	ISO	RGD:1323572	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Trps1	Rat	mercury dibromide	increases expression	ISO	RGD:1323571	6480464	mercuric bromide results in increased expression of TRPS1 mRNA	CTD	PMID:26272509
Trps1	Rat	mercury dibromide	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Trps1	Rat	methylmercury chloride	increases expression	ISO	RGD:1323571	6480464	methylmercuric chloride results in increased expression of TRPS1 mRNA	CTD	PMID:28001369
Trps1	Rat	nickel atom	decreases expression	ISO	RGD:1323571	6480464	Nickel results in decreased expression of TRPS1 mRNA	CTD	PMID:25583101
Trps1	Rat	panobinostat	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Trps1	Rat	panobinostat	increases expression	ISO	RGD:1323571	6480464	panobinostat results in increased expression of TRPS1 mRNA	CTD	PMID:26272509
Trps1	Rat	paracetamol	affects expression	ISO	RGD:1323572	6480464	Acetaminophen affects the expression of TRPS1 mRNA	CTD	PMID:17562736
Trps1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of TRPS1 mRNA	CTD	PMID:33387578
Trps1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of TRPS1 mRNA	CTD	PMID:35163327
Trps1	Rat	phenylmercury acetate	increases expression	ISO	RGD:1323571	6480464	Phenylmercuric Acetate results in increased expression of TRPS1 mRNA	CTD	PMID:26272509
Trps1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Trps1	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	RGD:1323572	6480464	Pregnenolone Carbonitrile results in decreased expression of TRPS1 mRNA	CTD	PMID:22698814
Trps1	Rat	SB 431542	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Trps1	Rat	silver atom	decreases expression	ISO	RGD:1323572	6480464	Silver results in decreased expression of TRPS1 mRNA	CTD	PMID:27131904
Trps1	Rat	silver(0)	decreases expression	ISO	RGD:1323572	6480464	Silver results in decreased expression of TRPS1 mRNA	CTD	PMID:27131904
Trps1	Rat	sodium arsenate	increases expression	ISO	RGD:1323572	6480464	sodium arsenate results in increased expression of TRPS1 mRNA	CTD	PMID:21795629
Trps1	Rat	sodium arsenite	increases expression	ISO	RGD:1323571	6480464	sodium arsenite results in increased expression of TRPS1 mRNA	CTD	PMID:22714537
Trps1	Rat	sodium arsenite	decreases expression	ISO	RGD:1323572	6480464	sodium arsenite results in decreased expression of TRPS1 mRNA	CTD	PMID:36209798\|PMID:37682722
Trps1	Rat	sodium arsenite	affects methylation	ISO	RGD:1323571	6480464	sodium arsenite affects the methylation of TRPS1 gene	CTD	PMID:28589171
Trps1	Rat	succimer	multiple interactions	ISO	RGD:1323572	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TRPS1 mRNA; [Succimer co-treated more ...	CTD	PMID:21641980\|PMID:26378955
Trps1	Rat	sulforaphane	increases expression	ISO	RGD:1323571	6480464	sulforaphane results in increased expression of TRPS1 mRNA	CTD	PMID:26833863
Trps1	Rat	sunitinib	decreases expression	ISO	RGD:1323571	6480464	Sunitinib results in decreased expression of TRPS1 mRNA	CTD	PMID:31533062
Trps1	Rat	tetrachloroethene	decreases expression	ISO	RGD:1323572	6480464	Tetrachloroethylene results in decreased expression of TRPS1 mRNA	CTD	PMID:28973375
Trps1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of TRPS1 mRNA	CTD	PMID:34492290
Trps1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1323572	6480464	titanium dioxide results in decreased methylation of TRPS1 promoter	CTD	PMID:35295148
Trps1	Rat	topotecan	decreases expression	EXP		6480464	Topotecan results in decreased expression of TRPS1 mRNA	CTD	PMID:25729387
Trps1	Rat	trichostatin A	increases expression	ISO	RGD:1323571	6480464	trichostatin A results in increased expression of TRPS1 mRNA	CTD	PMID:24935251\|PMID:26272509
Trps1	Rat	trichostatin A	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Trps1	Rat	triptonide	decreases expression	ISO	RGD:1323572	6480464	triptonide results in decreased expression of TRPS1 mRNA	CTD	PMID:33045310
Trps1	Rat	valproic acid	affects expression	ISO	RGD:1323571	6480464	Valproic Acid affects the expression of TRPS1 mRNA	CTD	PMID:25979313
Trps1	Rat	valproic acid	affects splicing	EXP		6480464	Valproic Acid affects the splicing of TRPS1 mRNA	CTD	PMID:29427782
Trps1	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of TRPS1 mRNA	CTD	PMID:29427782
Trps1	Rat	valproic acid	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Trps1	Rat	valproic acid	increases expression	ISO	RGD:1323571	6480464	Valproic Acid results in increased expression of TRPS1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369
Trps1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of TRPS1 mRNA	CTD	PMID:19015723
Trps1	Rat	vorinostat	increases expression	ISO	RGD:1323571	6480464	vorinostat results in increased expression of TRPS1 mRNA	CTD	PMID:26272509
Trps1	Rat	vorinostat	multiple interactions	ISO	RGD:1323571	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	biological_process		ND		1598407	2/2007: no relevant rat data	RGD
Trps1	Rat	cell surface receptor protein serine/threonine kinase signaling pathway	acts_upstream_of_or_within	ISO	RGD:1323572	1624291	MGI:107191\|MGI:1346865\|MGI:95688 PMID:18363966	RGD	PMID:18363966
Trps1	Rat	chondrocyte differentiation	acts_upstream_of_or_within	ISO	RGD:1323572	1624291	MGI:107191\|MGI:95688 PMID:18363966	RGD	PMID:18363966
Trps1	Rat	hair follicle development	involved_in	ISO	RGD:1323572	1624291	PMID:23133399	RGD	PMID:23133399
Trps1	Rat	negative regulation of DNA-templated transcription	involved_in	ISO	RGD:1323572	1624291	PMID:23133399	RGD	PMID:23133399
Trps1	Rat	negative regulation of DNA-templated transcription	acts_upstream_of_or_within	ISO	RGD:1323572	1624291	PR:P56546 PMID:12444977	RGD	PMID:12444977
Trps1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1323571	1624291	PMID:12885770, PMID:14680804, PMID:21673316	RGD	PMID:12885770\|PMID:14680804\|PMID:21673316
Trps1	Rat	positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	acts_upstream_of_or_within	ISO	RGD:1323572	1624291	MGI:107191\|MGI:95484 PMID:18363966	RGD	PMID:18363966
Trps1	Rat	regulation of chondrocyte differentiation	involved_in	ISO	RGD:1323572	1624291	PMID:19389374	RGD	PMID:19389374
Trps1	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR000679\|InterPro:IPR013088	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trps1	Rat	regulation of gene expression	involved_in	IEA	ARBA:ARBA00028334	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Trps1	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	PANTHER:PTN002931555\|UniProtKB:Q9UHF7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Trps1	Rat	skeletal system development	involved_in	ISO	RGD:1323571	1624291	PMID:10615131	RGD	PMID:10615131

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	chromatin	located_in	ISO	RGD:1323571	1624291	PMID:21673316	RGD	PMID:21673316
Trps1	Rat	nucleoplasm	located_in	ISO	RGD:1323571\|UniProtKB:Q9UHF7-1\|UniProtKB:Q9UHF7-2\|UniProtKB:Q9UHF7-3	1624291		RGD	GO_REF:0000052
Trps1	Rat	nucleus	located_in	ISO	RGD:1323571	1624291	PMID:12885770	RGD	PMID:12885770
Trps1	Rat	nucleus	located_in	ISO	RGD:1323572	1624291	PMID:18363966	RGD	PMID:18363966
Trps1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Trps1	Rat	nucleus	located_in	IEA	InterPro:IPR028440	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trps1	Rat	protein-containing complex	part_of	ISO	RGD:1323571	1624291	PMID:15491138	RGD	PMID:15491138

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Trps1	Rat	DNA-binding transcription factor activity	enables	IEA	InterPro:IPR028440	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trps1	Rat	DNA-binding transcription repressor activity, RNA polymerase II-specific	enables	ISO	RGD:1323571	1624291	PMID:14680804	RGD	PMID:14680804
Trps1	Rat	protein binding	enables	ISO	RGD:1323571	1624291	UniProtKB:P10071\|UniProtKB:P78317\|UniProtKB:Q9H2S9\|UniProtKB:Q9Q2G4 PMID:12885770, PMID:15491138, PMID:19389374, PMID:22190034	RGD	PMID:12885770\|PMID:15491138\|PMID:19389374\|PMID:22190034
Trps1	Rat	protein binding	enables	ISO	RGD:1323572	1624291	PR:P56546\|UniProtKB:Q61602\|UniProtKB:Q9QZS2 PMID:12444977, PMID:12885770, PMID:19389374	RGD	PMID:12444977\|PMID:12885770\|PMID:19389374
Trps1	Rat	protein domain specific binding	enables	ISO	RGD:1323571	1624291	UniProtKB:Q9H2S9 PMID:15491138	RGD	PMID:15491138
Trps1	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	ISO	RGD:1323571	1624291	PMID:14680804	RGD	PMID:14680804
Trps1	Rat	RNA polymerase II transcription regulatory region sequence-specific DNA binding	enables	IBA	PANTHER:PTN002931555\|UniProtKB:Q9UHF7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Trps1	Rat	sequence-specific DNA binding	enables	IEA	InterPro:IPR000679	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trps1	Rat	zinc ion binding	enables	IEA	InterPro:IPR013088	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Trps1	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

bone development disease (ISO)

brachydactyly (ISO)

CAKUT (ISO)

carcinoma (ISO)

Craniofacial Abnormalities (ISO)

Craniosynostosis Syndrome, Autosomal Recessive (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

hereditary multiple exostoses (ISO)

Metaphyseal Chondrodysplasia (ISO)

microcephaly (ISO)

osteochondrodysplasia (ISO)

Trichorhinophalangeal Syndrome (ISO)

trichorhinophalangeal syndrome type I (ISO,ISS)

trichorhinophalangeal syndrome type II (ISO)

trichorhinophalangeal syndrome type III (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,4-methylenedioxymethamphetamine (EXP)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-Zearalanol (EXP)

amphotericin B (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

calciol (EXP)

chloroprene (EXP)

chlorpyrifos (ISO)

choline (ISO)

cobalt dichloride (EXP)

coumarin (ISO)

DDE (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dichloromethane (ISO)

diquat (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

fenvalerate (EXP)

folic acid (ISO)

formaldehyde (ISO)

FR900359 (ISO)

gentamycin (EXP)

geraniol (ISO)

L-methionine (ISO)

mercury dibromide (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cell surface receptor protein serine/threonine kinase signaling pathway (ISO)

chondrocyte differentiation (ISO)

hair follicle development (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of extrinsic apoptotic signaling pathway via death domain receptors (ISO)

regulation of chondrocyte differentiation (ISO)

regulation of DNA-templated transcription (IEA)

regulation of gene expression (IEA)

regulation of transcription by RNA polymerase II (IBA)

skeletal system development (ISO)

Cellular Component

chromatin (ISO)

nucleoplasm (ISO)

nucleus (IEA,ISO)

protein-containing complex (ISO)

Molecular Function

DNA-binding transcription factor activity (IEA)

DNA-binding transcription repressor activity, RNA polymerase II-specific (ISO)

protein binding (ISO)

protein domain specific binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific DNA binding (IEA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Mutations in a new gene, encoding a zinc-finger protein, cause tricho-rhino-phalangeal syndrome type I.	Momeni P, etal., Nat Genet. 2000 Jan;24(1):71-4.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12444977	PMID:12885770	PMID:14680804	PMID:15491138	PMID:18363966	PMID:19389374	PMID:21673316	PMID:23133399

Genomics

Comparative Map Data

Trps1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	83,806,121 - 84,032,609 (-)	NCBI		GRCr8
mRatBN7.2	7	81,916,668 - 82,142,733 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	81,921,601 - 82,141,905 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	83,803,208 - 84,022,882 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	86,005,758 - 86,225,442 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	85,848,280 - 86,067,966 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	90,085,895 - 90,320,430 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	90,090,828 - 90,318,221 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	90,113,508 - 90,343,325 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	86,855,378 - 87,076,668 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	86,876,430 - 87,097,949 (-)	NCBI
Celera	7	78,810,727 - 79,029,498 (-)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

TRPS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	115,408,496 - 115,668,975 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	115,408,496 - 115,809,673 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	116,420,724 - 116,681,202 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	116,489,900 - 116,750,402 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	116,489,899 - 116,750,429	NCBI
Celera	8	112,607,772 - 112,867,949 (-)	NCBI		Celera
Cytogenetic Map	8	q23.3	NCBI
HuRef	8	111,746,115 - 111,962,229 (-)	NCBI		HuRef
CHM1_1	8	116,461,345 - 116,721,859 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	116,535,995 - 116,796,128 (-)	NCBI		T2T-CHM13v2.0

Trps1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	50,518,149 - 50,754,027 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	50,518,148 - 50,753,859 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	50,654,757 - 50,890,631 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	50,654,752 - 50,890,463 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	50,486,303 - 50,721,587 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	50,490,516 - 50,720,115 (-)	NCBI		MGSCv36	mm8
Celera	15	52,221,354 - 52,433,937 (-)	NCBI		Celera
Cytogenetic Map	15	C	NCBI
cM Map	15	19.18	NCBI

Trps1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	21,680,116 - 21,913,173 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955417	21,674,545 - 21,913,137 (-)	NCBI	ChiLan1.0	ChiLan1.0

TRPS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	132,802,726 - 133,069,136 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	108,326,565 - 108,588,056 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	112,079,147 - 112,339,567 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	114,626,357 - 114,854,222 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

TRPS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	15,017,180 - 15,273,177 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	15,022,652 - 15,273,666 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	15,005,955 - 15,263,461 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	15,305,244 - 15,563,018 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	15,308,610 - 15,562,778 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	15,053,664 - 15,309,547 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	15,150,277 - 15,407,958 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	15,394,399 - 15,652,945 (-)	NCBI		UU_Cfam_GSD_1.0

Trps1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	23,004,744 - 23,244,503 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	30,432,625 - 30,665,091 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	30,475,779 - 30,666,546 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRPS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	22,905,637 - 23,159,546 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	22,905,627 - 23,162,862 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TRPS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	110,048,277 - 110,306,342 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	110,050,705 - 110,260,394 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	30,041,925 - 30,303,926 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trps1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	13,798,113 - 14,035,138 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624763	13,792,649 - 14,035,120 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Trps1
1393 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	158
Count of miRNA genes:	131
Interacting mature miRNAs:	133
Transcripts:	ENSRNOT00000050774
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631513	Scl7	Serum cholesterol level QTL 7	4.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	37960569	82960569	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat

Markers in Region

AI447310

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	81,919,710 - 81,919,825 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	90,088,938 - 90,089,052	NCBI	Rnor6.0
Rnor_5.0	7	90,116,994 - 90,117,108	UniSTS	Rnor5.0
RGSC_v3.4	7	86,853,488 - 86,853,602	UniSTS	RGSC3.4
Celera	7	78,808,837 - 78,808,951	UniSTS
Cytogenetic Map	7	q31	UniSTS

AU046994

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	82,131,965 - 82,132,073 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	90,308,833 - 90,308,940	NCBI	Rnor6.0
Rnor_5.0	7	90,333,937 - 90,334,044	UniSTS	Rnor5.0
RGSC_v3.4	7	87,067,280 - 87,067,387	UniSTS	RGSC3.4
Celera	7	79,020,126 - 79,020,217	UniSTS
Cytogenetic Map	7	q31	UniSTS

BM384689

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	81,921,484 - 81,921,643 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	90,090,712 - 90,090,870	NCBI	Rnor6.0
Rnor_5.0	7	90,118,768 - 90,118,926	UniSTS	Rnor5.0
RGSC_v3.4	7	86,855,262 - 86,855,420	UniSTS	RGSC3.4
Celera	7	78,810,611 - 78,810,769	UniSTS
RH 3.4 Map	7	537.4	UniSTS
Cytogenetic Map	7	q31	UniSTS

Trps1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	82,099,874 - 82,100,574 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	90,276,663 - 90,277,362	NCBI	Rnor6.0
Rnor_5.0	7	90,301,767 - 90,302,466	UniSTS	Rnor5.0
Celera	7	78,988,051 - 78,988,750	UniSTS
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594744	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594745	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594747	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078761	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039078768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050774 ⟹ ENSRNOP00000039913

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	81,921,601 - 82,141,354 (-)	Ensembl
Rnor_6.0 Ensembl	7	90,090,828 - 90,318,221 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094294 ⟹ ENSRNOP00000077022

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	81,921,601 - 82,141,551 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097264 ⟹ ENSRNOP00000088310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	81,921,601 - 82,141,905 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106247 ⟹ ENSRNOP00000083606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	81,921,601 - 82,141,551 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110775 ⟹ ENSRNOP00000096700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	81,921,601 - 82,100,639 (-)	Ensembl

RefSeq Acc Id:

NM_001134837 ⟹ NP_001128309

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,811,497 - 84,031,235 (-)	NCBI
mRatBN7.2	7	81,921,601 - 82,141,354 (-)	NCBI
Rnor_6.0	7	90,090,828 - 90,318,221 (-)	NCBI
Rnor_5.0	7	90,113,508 - 90,343,325 (-)	NCBI
RGSC_v3.4	7	86,855,378 - 87,076,668 (-)	RGD
Celera	7	78,810,727 - 79,029,498 (-)	RGD

Sequence:

show sequence

CCCCACTCCCCCTCGCTGTCTCTTGCTGGCTGATTTTAATTCTCTCCTACCGGGAGCAGCAGAG
GATCTGGAGGTGGCTGGACCCGAGGGGCCGCCGCCGCCGCCGCTGCAAGTTTTCTGGGGGCTCC
TGGCAAACGGGGAGCAGACTAGGCACCGGCATGCAGAGTAAAGCAGTATTGTTTGAACAAAGAT
ATGGTCCGGAAAAAGAACCCCCCTCTGAGAAACGTTGCTAGTGAAGGCGAGGGTCAAACCCTGG
AGCCAACAGCTACAGAGAGCAAGGCATCTGGGAAGAACAAAGAATTTTCTGCAGATCAGATGTC
AGAAAATACAGATCAGAGTGATGTTGCAGAATTGAACACGAAGGAGGAACACAGCACGCATGGC
CAAGAGCCGTCTTCGAGCAGTAAGAAGGACTTGCAAATCTCAGGCCTGAGTGAGAAGGCTGGCT
TCAATTATGAAAGCCCCAGTAAGGGAGGGAACCTTGCCTCCTTCCCACATGATGAGGTAACAGA
CAGAAATATGTTGGCTTTCTCATCTCCAGCTGCTGGGGGAGTCTGCGAGCCCTTGAAGTCTCCT
CAAAGAGCAGAGGCAGATGACCCTCAAGATATGGCCTGCACCCCATCAGGGGATTCACTGGAGA
CAAAGGAAGATCATAAAATGTCACCAAAGGCCACTGAGGAAACAGGGCCAGTGCAGAGTGGTCA
AGCCAATTGTCAAGGTTTGAGTCCAGTTTCCGTGGCCTCAAAAAACCCACAAGTGCCTTCAGAT
GGGGGTGTCAGACTGAGTAAACCCAAAAGTGACTTACTGGTGAGTGACAACCCAGACCCGGCAC
CTCTGTCTCCAGAGCTTCAGGACTTTAAATGCAATATCTGTGGATACGGTTACTATGGCAATGA
CCCCACAGATCTGATTAAGCACTTCCGAAAGTATCACTTAGGACTGCATAATCGCACCAGGCAG
GATGCTGAGCTGGACAGCAAAATCTTGGCCCTTCATAACATGGTGCAGTTCAGCCATTCCAAAG
ACTTCCAGAAGGTCAACCGTTCTGTGCTTTCTGGCGTGCTGCAGGATATCAGCTCTTCACGGCC
TGCGCTACTAAATGGGACCTATGATGTACAGGTCACTTCAGGTGGAACGTTCATTGGCATTGGA
CGGAAAACTCCCGATTGCCAAGGCAACACCAAGTATTTCCGCTGCAAATTCTGCAATTTCACTT
ACATGGGCAACTCGTCAACTGAACTAGAACAACATTTTCTTCAGACTCACCCGAATAAAATCAA
AGTGTCTCTCCCGTCCTCCGAGGGCGTGAAAGCTTCAGAGAAAAACTCTAACAAATCCATCCCT
GCGCTTCGAGCCAGTGACTCTGGGGATGTAGGAAAATGGCAGGACAAAATGACAGTCAAAGCTG
GAGATGACACCCCTGTCGGCTACTCAGTGCCCATCAAGCCCCTCGATTCCTCACGACAAAATGG
TACAGAGGCCACCAGTTATTACTGGTGTAAATTTTGTAGTTTCAGCTGTGAGTCATCTAGCTCG
CTTAAGCTGCTAGAACATTACGGCAAGCAGCATGGAGCAGTGCAGTCGGGCGGCCTTAATCCAG
AGTTGAATGACAAACTTCCCAGGGGCTCTGTCATTAATCAAAATGATCTAGCCAAAAGTGTAGA
AGGAGAGCCATTGACCAAGCCAGAAAAGGGCTTGAGTGGGGCTAAAAAGAAGGACTTCCCCAGC
AAGGGAGCAGAGGATAATATGGTAACGAGCTATAACTGTCAGTTCTGTGACTTTAGATATTCCA
AAAGCCATGGCCCTGATGTGATTGTAGTGGGTCCACTTCTCCGTCATTATCAGCAACTCCATAA
CATCCACAAGTGTACCATTAAGCATTGTCCATTCTGTCCCAGAGGCCTTTGCAGCCCAGAAAAG
CACCTTGGAGAAATTACTTATCCGTTTGCTTGTAGAAAAAGTAATTGTTCCCACTGTGCACTCT
TGCTGTTACACTTGTCTCCTGGGGTGGCCGGAAGTTCCAGAGTCAAACACCAATGCCACCAGTG
TTCCTTCTCTACCCCCGATGTAGATGTGCTCCTCTTTCACTATGAGACCATGCATGAGTCCCAA
GCATCGGATGTCAAACAAGAGGTAAACCACCTGCTAGGATCTGAAGGGCAGCAGGCTGCCAGGG
ACAGCAAGGAACACTCGTGCACCAAATGTGATTTTATAACCCAGGTGGAAGAAGAGATCTCTAG
ACACTACAGGAGAGCACACAGCTGCTATAAATGTCGTCAGTGCAGTTTCACAGCTGGTGACACT
CAGTCACTGTTGGAGCACTTCAACACGGTTCACTGCCAGGAACAGGAAGTAGCTACTGCTAATG
GCGAAGAGGATGGCCATGCCATACCCACCATCAAGGAAGAGCCCAAAATTGATCTCAAGGTCTA
CAGTCTGCTAAACCCAGACTCTAAAATGGGAGAGACAGTTCCCGAGAGCATAGTTAAGAGAGAG
AAACTTGATGACAAGGAAGGGCTAAAAGATAAAATCTGGACGGAGAGTTCAACTGATGACCTTC
GTGGTGTGACTTGGAGAGGAGCCGACATCCTACGGGGTAGTCCATCCTATACTCAAGCAAGTCT
GGGGCTCTTGACGCCTGTGTCCAGCTCCCAAGAGCAGACAAAGACTCTGAGGGACAGCCCCAAT
GTCGAAGCTGCCCACCTGGCCCGACCTATGTATGGCTTGGCTGTCGATACCAAGGGCTTCCTGC
AAGGGGCTCCTGCTGGTGGCGAGAAGTCTGCATCTCTCACTCAGCAGTATCCTGCTTCTGGAGA
GGGCAAGACCAAGGACGAATCCCAGTCGCTGTTACGGAGGCGAAGAGGCTCTGGTGTTTTTTGT
GCCAATTGCCTGACCACAAAGACCTCTCTCTGGCGAAAGAATGCAAATGGCGGATATGTATGCA
ACGCATGTGGCCTCTACCAGAAACTTCACTCGACTCCCAGGCCTTTAAACATCATTAAACAAAA
CAACGGCGAGCAGATTATTAGAAGACGGACAAGAAAGCGCCTTAACCCAGAGGCACTTCAGGCT
GAGCAACTCAACAAACAGCAGAGGGGAAGTGGGGAGGAGCAGGTCAATGGAAGCCCCTTAGAGA
GGAGGTCAGAAGATCACTTAAGTGAAAGTCATCAGAGAGAAATTCCACTTCCGAGCCTGAGTAA
ATACGAAGCCCAGGGTTCATTGACTAAAAGCCATTCTGCTCAACAGCCGGTCCTGGTCAGCCAA
ACTCTGGATATTCACAAAAGGATGCAGCCTTTGCACATTCAGATAAAAAGTCCTCAGGAAAGTA
CTGGAGATCCAGGAAACAGTTCATCCGTATCTGATGGGAAAGGAAGTTCTGAAAGAGGCAGCCC
CATAGAAAAGTACATGAGGCCTGCAAAACACCCCAACTATTCTCCACCAGGCAGCCCCATCGAA
AAGTACCAATACCCACTTTTTGGAGTTCCTTTTGTACATAATGACTTCCAGAGTGAAGCTGATT
GGCTACGGTTCTGGAGTAAATATAAGCTCTCTGTTCCTGGGAATCCGCACTACTTGAGTCATGT
GCCTGGCTTACCAAATCCTTGCCAAAACTATGTGCCTTATCCCACCTTCAATCTGCCTCCTCAT
TTCTCAGCTGTTGGATCAGACAATGACATTCCTCTAGATTTGGCGATCAAGCATTCCAGACCTG
GGCCAACTGCAAATGGTGCCGCCAAGGAGAAAAGCAAGGCACCATCAAACGTAAAAAATGAAGG
TCCCTTGAATGTAGTTAAGACGGAGAAAGTTGACAGAAGCACTCAAGATGAACTTTCAACGAAA
TGTGTGCACTGTGGCATTGTTTTCCTGGATGAAGTGATGTATGCTTTGCATATGAGTTGCCATG
GTGACAGTGGACCTTTCCAGTGCAGCATATGCCAGCATCTTTGCACGGACAAATATGACTTCAC
AACACATATCCAGAGGGGCCTGCATAGGAACAATGCACAAGCAGAAAAAAATGGAAAACCTAAA
GAGTAAAACCTTAGCACTTAGCACAATTAAATAGAAATAGGTTTTCTTGATGGGAATTCAATAG
CTTGTAATGTCTTATGAAGACTTATTAAAAAAATAATTCATAGAGCCTGCCTTACCCAACATGA
AATTCCCTTTTTCTTAATTTCTTTCTTTTGATGAGTAGGTTACCAAGATTTTAAAATGAAACAT
ATGGTCAGTGAGAAAGAATGGAATTGATAGATAATTTTTTAAAAAAAAAAAAGGAGAACTAGAG
TGAAAATGATCTTACCTAATGTGTACTGCTGAATCTCTGTACAGAGGCCCAACCAAATTATAGC
CATTTGTTTGTAAAGATACAAATGCTCTCTATTGTTTGAAGGAGTTTACATACTATCATGTGAC
AGCAGTATTAGGCTGGCTATTGGCCCATCCATTCAGATTAGGTTGCCTACAACTTAAAATATCA
TGAGATCTCAGCCAAAGGAGGAGAAAAAAAAATCTCCAGGGCAATGGAAGAAAAAATGGCACCT
CTCAAAGTAGGCTCCTCTCATTGACCATGTTTC

hide sequence

RefSeq Acc Id:

XM_039078760 ⟹ XP_038934688

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,031,020 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,141,137 (-)	NCBI

RefSeq Acc Id:

XM_039078761 ⟹ XP_038934689

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,031,019 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,141,137 (-)	NCBI

RefSeq Acc Id:

XM_039078762 ⟹ XP_038934690

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,031,677 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,141,686 (-)	NCBI

RefSeq Acc Id:

XM_039078764 ⟹ XP_038934692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,001,792 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,105,530 (-)	NCBI

RefSeq Acc Id:

XM_039078765 ⟹ XP_038934693

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,032,609 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,142,733 (-)	NCBI

RefSeq Acc Id:

XM_039078767 ⟹ XP_038934695

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,030,447 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,140,568 (-)	NCBI

RefSeq Acc Id:

XM_039078768 ⟹ XP_038934696

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,031,020 (-)	NCBI
mRatBN7.2	7	81,916,668 - 82,141,138 (-)	NCBI

RefSeq Acc Id:

XM_063263244 ⟹ XP_063119314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	83,806,121 - 84,031,675 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001128309	(Get FASTA)	NCBI Sequence Viewer
	XP_038934688	(Get FASTA)	NCBI Sequence Viewer
	XP_038934689	(Get FASTA)	NCBI Sequence Viewer
	XP_038934690	(Get FASTA)	NCBI Sequence Viewer
	XP_038934692	(Get FASTA)	NCBI Sequence Viewer
	XP_038934693	(Get FASTA)	NCBI Sequence Viewer
	XP_038934695	(Get FASTA)	NCBI Sequence Viewer
	XP_038934696	(Get FASTA)	NCBI Sequence Viewer
	XP_063119314	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM16291	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000039913
	ENSRNOP00000039913.3
	ENSRNOP00000077022
	ENSRNOP00000077022.1
	ENSRNOP00000083606
	ENSRNOP00000083606.1
	ENSRNOP00000088310.1
	ENSRNOP00000096700
	ENSRNOP00000096700.1
	ENSRNOP00000110301
	ENSRNOP00000110847

RefSeq Acc Id:

NP_001128309 ⟸ NM_001134837

- UniProtKB:

A6HRD1 (UniProtKB/TrEMBL), A0A8I5Y133 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVRKKNPPLRNVASEGEGQTLEPTATESKASGKNKEFSADQMSENTDQSDVAELNTKEEHSTHG
QEPSSSSKKDLQISGLSEKAGFNYESPSKGGNLASFPHDEVTDRNMLAFSSPAAGGVCEPLKSP
QRAEADDPQDMACTPSGDSLETKEDHKMSPKATEETGPVQSGQANCQGLSPVSVASKNPQVPSD
GGVRLSKPKSDLLVSDNPDPAPLSPELQDFKCNICGYGYYGNDPTDLIKHFRKYHLGLHNRTRQ
DAELDSKILALHNMVQFSHSKDFQKVNRSVLSGVLQDISSSRPALLNGTYDVQVTSGGTFIGIG
RKTPDCQGNTKYFRCKFCNFTYMGNSSTELEQHFLQTHPNKIKVSLPSSEGVKASEKNSNKSIP
ALRASDSGDVGKWQDKMTVKAGDDTPVGYSVPIKPLDSSRQNGTEATSYYWCKFCSFSCESSSS
LKLLEHYGKQHGAVQSGGLNPELNDKLPRGSVINQNDLAKSVEGEPLTKPEKGLSGAKKKDFPS
KGAEDNMVTSYNCQFCDFRYSKSHGPDVIVVGPLLRHYQQLHNIHKCTIKHCPFCPRGLCSPEK
HLGEITYPFACRKSNCSHCALLLLHLSPGVAGSSRVKHQCHQCSFSTPDVDVLLFHYETMHESQ
ASDVKQEVNHLLGSEGQQAARDSKEHSCTKCDFITQVEEEISRHYRRAHSCYKCRQCSFTAGDT
QSLLEHFNTVHCQEQEVATANGEEDGHAIPTIKEEPKIDLKVYSLLNPDSKMGETVPESIVKRE
KLDDKEGLKDKIWTESSTDDLRGVTWRGADILRGSPSYTQASLGLLTPVSSSQEQTKTLRDSPN
VEAAHLARPMYGLAVDTKGFLQGAPAGGEKSASLTQQYPASGEGKTKDESQSLLRRRRGSGVFC
ANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRRRTRKRLNPEALQA
EQLNKQQRGSGEEQVNGSPLERRSEDHLSESHQREIPLPSLSKYEAQGSLTKSHSAQQPVLVSQ
TLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSDGKGSSERGSPIEKYMRPAKHPNYSPPGSPIE
KYQYPLFGVPFVHNDFQSEADWLRFWSKYKLSVPGNPHYLSHVPGLPNPCQNYVPYPTFNLPPH
FSAVGSDNDIPLDLAIKHSRPGPTANGAAKEKSKAPSNVKNEGPLNVVKTEKVDRSTQDELSTK
CVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPK
E

hide sequence

Ensembl Acc Id:

ENSRNOP00000039913 ⟸ ENSRNOT00000050774

RefSeq Acc Id:	XP_038934693 ⟸ XM_039078765
- Peptide Label:	isoform X4
- UniProtKB:	D3ZEM6 (UniProtKB/TrEMBL), A0A8I5Y133 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934690 ⟸ XM_039078762
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I5Y133 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934696 ⟸ XM_039078768
- Peptide Label:	isoform X6
- UniProtKB:	A0A8I5Y133 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934689 ⟸ XM_039078761
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5Y133 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934688 ⟸ XM_039078760
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5Y133 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934695 ⟸ XM_039078767
- Peptide Label:	isoform X4
- UniProtKB:	D3ZEM6 (UniProtKB/TrEMBL), A0A8I5Y133 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038934692 ⟸ XM_039078764
- Peptide Label:	isoform X4
- UniProtKB:	D3ZEM6 (UniProtKB/TrEMBL), A0A8I5Y133 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083606 ⟸ ENSRNOT00000106247

Ensembl Acc Id:

ENSRNOP00000096700 ⟸ ENSRNOT00000110775

Ensembl Acc Id:

ENSRNOP00000077022 ⟸ ENSRNOT00000094294

Ensembl Acc Id:

ENSRNOP00000088310 ⟸ ENSRNOT00000097264

RefSeq Acc Id:	XP_063119314 ⟸ XM_063263244
- Peptide Label:	isoform X5
- UniProtKB:	A0A8I5ZWX6 (UniProtKB/TrEMBL), A0A8I5Y133 (UniProtKB/TrEMBL)

Protein Domains

C2H2-type GATA-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZEM6-F1-model_v2	AlphaFold	D3ZEM6	1-1281	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695321

Promoter ID:

EPDNEW_R5846

Type:

multiple initiation site

Name:

Trps1_1

Description:

transcriptional repressor GATA binding 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	90,318,190 - 90,318,250	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311883	AgrOrtholog
BioCyc Gene	G2FUF-33445	BioCyc
Ensembl Genes	ENSRNOG00000024998	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050774	ENTREZGENE
	ENSRNOT00000050774.3	UniProtKB/TrEMBL
	ENSRNOT00000094294	ENTREZGENE
	ENSRNOT00000094294.1	UniProtKB/TrEMBL
	ENSRNOT00000097264.1	UniProtKB/TrEMBL
	ENSRNOT00000106247	ENTREZGENE
	ENSRNOT00000106247.1	UniProtKB/TrEMBL
	ENSRNOT00000110775	ENTREZGENE
	ENSRNOT00000110775.1	UniProtKB/TrEMBL
	ENSRNOT00000146817	ENTREZGENE
	ENSRNOT00000157182	ENTREZGENE
Gene3D-CATH	3.30.50.10	UniProtKB/TrEMBL
	Classic Zinc Finger	UniProtKB/TrEMBL
InterPro	Trps1	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
	Znf_C2H2_type	UniProtKB/TrEMBL
	Znf_GATA	UniProtKB/TrEMBL
	Znf_NHR/GATA	UniProtKB/TrEMBL
KEGG Report	rno:299897	UniProtKB/TrEMBL
NCBI Gene	299897	ENTREZGENE
PANTHER	PTHR47034	UniProtKB/TrEMBL
	ZINC FINGER TRANSCRIPTION FACTOR TRPS1	UniProtKB/TrEMBL
Pfam	GATA	UniProtKB/TrEMBL
PhenoGen	Trps1	PhenoGen
PRINTS	GATAZNFINGER	UniProtKB/TrEMBL
PROSITE	GATA_ZN_FINGER_1	UniProtKB/TrEMBL
	GATA_ZN_FINGER_2	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
	ZINC_FINGER_C2H2_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000024998	RatGTEx
SMART	ZnF_C2H2	UniProtKB/TrEMBL
	ZnF_GATA	UniProtKB/TrEMBL
Superfamily-SCOP	Glucocorticoid receptor-like (DNA-binding domain)	UniProtKB/TrEMBL
	SSF57667	UniProtKB/TrEMBL
UniProt	A0A8I5Y133	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZWX6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A7M4_RAT	UniProtKB/TrEMBL
	A0A8I6B4M4_RAT	UniProtKB/TrEMBL
	A6HRD1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZEM6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-19	Trps1	transcriptional repressor GATA binding 1	Trps1	trichorhinophalangeal syndrome I	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-09-29	Trps1	trichorhinophalangeal syndrome I	Trps1	trichorhinophalangeal syndrome I homolog (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-12-15	Trps1	trichorhinophalangeal syndrome I homolog (human)	Trps1	trichorhinophalangeal syndrome I (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Trps1	trichorhinophalangeal syndrome I (human)	Trps1_predicted	trichorhinophalangeal syndrome I (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Trps1_predicted	trichorhinophalangeal syndrome I (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM