Advanced Search (OLGA)

Gene: Osr1 (odd-skipped related transcription factor 1) Rattus norvegicus

Analyze

Symbol:

Osr1

Name:

odd-skipped related transcription factor 1

RGD ID:

1311807

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II transcription regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including embryonic limb morphogenesis; kidney development; and negative regulation of transporter activity. Predicted to act upstream of or within gonad development; intermediate mesoderm development; and metanephros development. Located in cell cortex and cytosol. Orthologous to human OSR1 (odd-skipped related transcription factor 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC298878; odd-skipped related 1; odd-skipped related 1 (Drosophila); odd-skipped related transciption factor 1; Odd1; protein odd-skipped-related 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OSR1 (odd-skipped related transcription factor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Osr1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Osr1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	OSR1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OSR1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Osr1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	OSR1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OSR1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Osr1 (odd-skipped related transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OSR1 (odd-skipped related transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Osr1 (odd-skipped related transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	osr1 (odd-skipped related transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	odd-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	bowl	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	odd	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	sob	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	odd-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	osr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	38,088,688 - 38,100,010 (+)	NCBI		GRCr8
mRatBN7.2	6	32,369,561 - 32,380,822 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	32,373,816 - 32,380,817 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	32,670,489 - 32,672,848 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	32,986,375 - 32,988,736 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	32,460,987 - 32,463,354 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	35,314,431 - 35,321,458 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	35,314,444 - 35,321,667 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	45,074,989 - 45,086,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	33,074,410 - 33,076,769 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	33,062,739 - 33,079,153 (+)	NCBI
Celera	6	31,814,629 - 31,816,988 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

buta-1,3-diene (ISO)

butan-1-ol (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cytarabine (ISO)

decabromodiphenyl ether (EXP)

dibutyl phthalate (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

eplerenone (ISO)

ethanol (ISO)

furan (EXP)

gentamycin (EXP)

iron dichloride (ISO)

mercury dichloride (EXP)

methapyrilene (ISO)

methotrexate (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nickel atom (ISO)

okadaic acid (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

progesterone (ISO)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

urethane (ISO)

valproic acid (ISO)

valsartan (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA,ISO)

cell proliferation involved in kidney development (IEA,ISO,ISS)

cellular response to retinoic acid (IEA,ISO)

chondrocyte differentiation (IEA,ISO)

embryonic digit morphogenesis (IEA,ISO)

embryonic forelimb morphogenesis (IEA,ISO)

embryonic hindlimb morphogenesis (IEA,ISO)

embryonic skeletal joint development (IEA,ISO)

embryonic skeletal joint morphogenesis (IEA,ISO)

embryonic skeletal limb joint morphogenesis (IEA,ISO)

gonad development (IEA,ISO)

heart development (IEA,ISO,ISS)

intermediate mesoderm development (IEA,ISO)

mesangial cell development (IEA,ISO,ISS)

mesonephric duct morphogenesis (IEA,ISO,ISS)

mesonephros development (IEA,ISO,ISS)

metanephric cap mesenchymal cell proliferation involved in metanephros development (IEA,ISO,ISS)

metanephric epithelium development (IEA,ISO,ISS)

metanephric glomerulus vasculature development (IEA,ISO,ISS)

metanephric interstitial fibroblast development (IEA,ISO,ISS)

metanephric mesenchymal cell differentiation (IEA,ISO,ISS)

metanephric mesenchyme development (IEA,ISO,ISS)

metanephric mesenchyme morphogenesis (IEA,ISO,ISS)

metanephric nephron tubule development (IEA,ISO,ISS)

metanephric smooth muscle tissue development (IEA,ISO,ISS)

metanephros development (IEA,ISO)

middle ear morphogenesis (IEA,ISO,ISS)

negative regulation of apoptotic process (IEA,ISO,ISS)

negative regulation of epithelial cell differentiation (IEA,ISO,ISS)

negative regulation of nephron tubule epithelial cell differentiation (IEA,ISO,ISS)

negative regulation of transcription by RNA polymerase II (IBA,IEA,ISO)

obsolete negative regulation of creatine transmembrane transporter activity (ISO)

obsolete negative regulation of sodium ion transmembrane transporter activity (ISO)

odontogenesis (IEA,ISO,ISS)

pattern specification involved in metanephros development (IEA,ISO,ISS)

pattern specification process (IBA)

positive regulation of bone mineralization (IEA,ISO)

positive regulation of epithelial cell proliferation (IEA,ISO,ISS)

positive regulation of gastrulation (IEA,ISO,ISS)

positive regulation of gene expression (IEA,ISO,ISS)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

posterior mesonephric tubule development (IEA,ISO,ISS)

pronephros development (IBA,IEA,ISO,ISS)

renal vesicle progenitor cell differentiation (IEA,ISO,ISS)

roof of mouth development (IEA,ISO,ISS)

sodium ion transmembrane transport (IEA,ISO)

specification of anterior mesonephric tubule identity (IEA,ISO,ISS)

specification of posterior mesonephric tubule identity (IEA,ISO,ISS)

stem cell differentiation (IEA,ISO,ISS)

ureter urothelium development (IEA,ISO,ISS)

ureteric bud development (IEA,ISO,ISS)

urogenital system development (IBA,IEA,ISO,ISS)

Cellular Component

cell cortex (IDA)

cytosol (IDA)

nucleus (IBA,IEA,ISO,ISS)

Molecular Function

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

metal ion binding (IEA)

protein binding (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (IBA)

sequence-specific double-stranded DNA binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Identification of the WNK-SPAK/OSR1 signaling pathway in rodent and human lenses.	Vorontsova I, etal., Invest Ophthalmol Vis Sci. 2014 Dec 16;56(1):310-21. doi: 10.1167/iovs.14-15911.

Additional References at PubMed

PMID:12477932	PMID:16223478	PMID:16669787	PMID:16790474	PMID:17547533	PMID:18835385	PMID:19307180	PMID:19389375	PMID:20171952	PMID:21262216	PMID:21281489	PMID:22238094
PMID:25531585

Genomics

Comparative Map Data

Osr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	38,088,688 - 38,100,010 (+)	NCBI		GRCr8
mRatBN7.2	6	32,369,561 - 32,380,822 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	32,373,816 - 32,380,817 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	32,670,489 - 32,672,848 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	32,986,375 - 32,988,736 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	32,460,987 - 32,463,354 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	35,314,431 - 35,321,458 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	35,314,444 - 35,321,667 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	45,074,989 - 45,086,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	33,074,410 - 33,076,769 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	33,062,739 - 33,079,153 (+)	NCBI
Celera	6	31,814,629 - 31,816,988 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

OSR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	19,344,874 - 19,358,623 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	19,351,485 - 19,358,623 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	19,551,246 - 19,558,384 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	19,414,727 - 19,421,853 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	19,413,711 - 19,420,835 (-)	NCBI		Celera
Cytogenetic Map	2	p24.1	NCBI
HuRef	2	19,308,802 - 19,315,925 (-)	NCBI		HuRef
CHM1_1	2	19,480,638 - 19,487,763 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	19,384,294 - 19,391,428 (-)	NCBI		T2T-CHM13v2.0

Osr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	9,624,442 - 9,631,500 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	9,620,116 - 9,631,500 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	9,574,442 - 9,581,500 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	9,570,116 - 9,581,500 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	9,581,248 - 9,588,306 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	9,600,505 - 9,606,919 (+)	NCBI		MGSCv36	mm8
Celera	12	9,956,176 - 9,963,227 (+)	NCBI		Celera
Cytogenetic Map	12	A1.1	NCBI
cM Map	12	4.05	NCBI

Osr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	1,953,370 - 1,961,390 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	1,954,470 - 1,961,344 (-)	NCBI	ChiLan1.0	ChiLan1.0

OSR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	107,175,816 - 107,183,009 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	107,179,842 - 107,186,981 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	19,333,101 - 19,340,267 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	19,451,067 - 19,458,229 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	19,451,067 - 19,458,229 (-)	Ensembl	panpan1.1		panPan2

OSR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	14,508,543 - 14,515,657 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	14,509,333 - 14,589,228 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	14,460,884 - 14,467,497 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	14,653,874 - 14,660,498 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	14,653,360 - 14,847,114 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	14,507,592 - 14,514,210 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	14,515,766 - 14,522,381 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	14,546,710 - 14,553,327 (-)	NCBI		UU_Cfam_GSD_1.0

Osr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	58,944,539 - 58,951,592 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	11,888,024 - 11,895,058 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	11,888,024 - 11,895,058 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OSR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	118,757,920 - 118,765,102 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	118,368,471 - 118,765,107 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	126,839,630 - 126,845,239 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OSR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	88,364,115 - 88,371,258 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	88,364,166 - 88,371,263 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	23,861,885 - 23,869,038 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Osr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	2,136,151 - 2,138,441 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	2,136,228 - 2,559,092 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Osr1
43 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	328
Count of miRNA genes:	191
Interacting mature miRNAs:	227
Transcripts:	ENSRNOT00000005666
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
1331779	Rf38	Renal function QTL 38	2.876		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	32074428	72227641	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat

Markers in Region

Osr1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	32,380,204 - 32,380,355 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	35,320,848 - 35,320,996	NCBI	Rnor6.0
Rnor_5.0	6	45,085,709 - 45,085,857	UniSTS	Rnor5.0
RGSC_v3.4	6	33,076,159 - 33,076,307	UniSTS	RGSC3.4
Celera	6	31,816,378 - 31,816,526	UniSTS
Cytogenetic Map	6	q14	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	80	79	48	25	48	6	207	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111941	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC159410	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005666 ⟹ ENSRNOP00000005666

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	32,373,816 - 32,380,816 (+)	Ensembl
Rnor_6.0 Ensembl	6	35,314,444 - 35,321,667 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104721 ⟹ ENSRNOP00000085278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	32,377,537 - 32,380,817 (+)	Ensembl

RefSeq Acc Id:

NM_001106716 ⟹ NP_001100186

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	38,097,651 - 38,100,010 (+)	NCBI
mRatBN7.2	6	32,378,456 - 32,380,817 (+)	NCBI
Rnor_6.0	6	35,319,099 - 35,321,458 (+)	NCBI
Rnor_5.0	6	45,074,989 - 45,086,319 (+)	NCBI
RGSC_v3.4	6	33,074,410 - 33,076,769 (+)	RGD
Celera	6	31,814,629 - 31,816,988 (+)	RGD

Sequence:

show sequence

CGCGGAACAAGATCGATTATTGAAGCCATTGCGGTTACCAGCGACAGAAATGGGCAGCAAAACC
TTGCCAGCACCGGTGCCCATCCACCCATCCCTGCAGCTTACCAATTACTCTTTCCTTCAGGCAG
TGAATGGCTTACCCACAGTGCCCTCGGACCACCTGCCCAACCTGTATGGTTTCAGCGCTCTTCA
CGCGGTGCATCTGCACCAATGGACGCTGGGCTACCCAGCCATGCACTTGCCTCGTTCCTCTTTT
TCTAAAGTGCCAGGTGCGGTGTCCAGCCTAATGGACGCTCGCTTCCAGCTGCCAGCTTTTCCCT
GGTTTCCACACGTCATTCACCCTAAGCCAGAGATCACCGCGGGAGGCAGCGGTGCAGCGCTTAA
GACCAAGCCGCGCTTTGATTTCGCTAACCTGGCCTTGGCTGCCACACAAGAGGATCCCACCAAG
CTTGGCCGAGGGGAGGGCCCTGGCTCCCCTGCTGGTGGGCTGGGCGCCCTCCTGGACGTGACCA
AGCTGTCTCCAGAAAAGAAGCCAACAAGGGGTCGCCTGCCTTCCAAGACCAAGAAGGAATTCGT
CTGCAAGTTCTGTGGCCGCCACTTCACTAAGTCCTATAACCTACTTATCCACGAGCGGACGCAC
ACCGATGAGCGGCCTTACACCTGTGACATCTGCCACAAAGCTTTCCGGAGGCAAGACCACCTAC
GGGACCACAGATATATTCACTCCAAAGAGAAGCCTTTCAAGTGTCAAGAGTGTGGAAAAGGATT
CTGCCAGTCCCGGACTCTCGCTGTCCACAAGACGCTACACTCACAAGTGAAGGAGCTCAAAACC
TCCAAGATCAAATGCTAAATAAACAAAGCCTGCGGGGCACCAGGAACCTGGGGCGTGCTGCCGC
CTTCTCTACTAGAGGGACCCGAGCTGAAGGCAACTCTGCGGGCAGCGGGAGGGGCTTTTGGGAT
CCTCGTTCCACAGCAACAAAGTCCCCTGGGTCCCTAGCGCTTGCGGCGCTCCTGAGCCTTGGCC
CGGGCCGCGACTCCTACAGCCTGGGCGGCTCTCCTAGGACGCGGCTAAAACTCTTGGCCAAAGG
GCGGTACTCAACTCACATGGCGGAAGGAAAACTGCATTAAAACACACACACACACACACACACA
CACACACACACACACACACACACACACACACACACACACACAACGAAAACTGCTGAGCCGCAGC
GGCGCCTCTCACAGAAGTATTACTTTTTCTATTGTTATTTTATACGTTTTCTTTATCCTCCTCC
CTCCCCTGACTATATAAGCTTGTAAAGTCTTGACTGTGGAGAGGGGGAAAGAAAAGATCTATGC
ACCCTGGCAATTTCCAGTCCCCCTTCCTTTCCCTATCCCCACACCGGGGAGCCTGCGAAAGTGT
AATCCTTGTATCTGCTTCTGCCATCCGGCCCCAGGGGCCGCTGGCTCCGCGCGACTCCTGGGCC
TCCAGCTGACCTTCAGCTCCGGGCGCGGAAACCGGGCTGAGAACCAGGCGCCCGGGGCTAGGGG
GGCCGAGCCTCCGCTCCCCTGTTCCAACGGTGCGTGTGAGCGAGCGAGCAGCCGGCCAGGAGCC
GGGCGTTGTATTGCGACTGGCACTTTATGCTGACATCGGTAACGGACATTTATCACTGGAGTTT
TTTTTTTAACTATTAAATAAACGGTTATTTTACAGGCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039111941 ⟹ XP_038967869

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	38,088,688 - 38,100,010 (+)	NCBI
mRatBN7.2	6	32,369,561 - 32,380,822 (+)	NCBI

RefSeq Acc Id:

XM_063261645 ⟹ XP_063117715

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	38,092,956 - 38,100,010 (+)	NCBI

RefSeq Acc Id:

XM_063261646 ⟹ XP_063117716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	38,092,957 - 38,100,010 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001100186	(Get FASTA)	NCBI Sequence Viewer
	XP_038967869	(Get FASTA)	NCBI Sequence Viewer
	XP_063117715	(Get FASTA)	NCBI Sequence Viewer
	XP_063117716	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI59411	(Get FASTA)	NCBI Sequence Viewer
	B0K011	(Get FASTA)	NCBI Sequence Viewer
	EDM03089	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005666
	ENSRNOP00000085278

RefSeq Acc Id:

NP_001100186 ⟸ NM_001106716

- UniProtKB:

B0K011 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHL
PRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFANLALAATQ
EDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLI
HERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQV
KELKTSKIKC

hide sequence

Ensembl Acc Id:

ENSRNOP00000005666 ⟸ ENSRNOT00000005666

RefSeq Acc Id:	XP_038967869 ⟸ XM_039111941
- Peptide Label:	isoform X1
- UniProtKB:	B0K011 (UniProtKB/Swiss-Prot)

Ensembl Acc Id:

ENSRNOP00000085278 ⟸ ENSRNOT00000104721

RefSeq Acc Id:	XP_063117715 ⟸ XM_063261645
- Peptide Label:	isoform X2
- UniProtKB:	A0A8L2Q278 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117716 ⟸ XM_063261646
- Peptide Label:	isoform X3

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0K011-F1-model_v2	AlphaFold	B0K011	1-266	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694492

Promoter ID:

EPDNEW_R5015

Type:

multiple initiation site

Name:

Osr1_1

Description:

odd-skipped related transciption factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	35,314,463 - 35,314,523	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311807	AgrOrtholog
BioCyc Gene	G2FUF-38164	BioCyc
Ensembl Genes	ENSRNOG00000004210	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000005666	ENTREZGENE
	ENSRNOT00000104721	ENTREZGENE
Gene3D-CATH	Classic Zinc Finger	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8366695	IMAGE-MGC_LOAD
InterPro	C2H2-ZF_Transcription_Reg	UniProtKB/Swiss-Prot
	Znf_C2H2_sf	UniProtKB/Swiss-Prot
	Znf_C2H2_type	UniProtKB/Swiss-Prot
KEGG Report	rno:298878	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188687	IMAGE-MGC_LOAD
NCBI Gene	298878	ENTREZGENE
PANTHER	ODD-SKIPPED - RELATED	UniProtKB/Swiss-Prot
	PROTEIN ODD-SKIPPED-RELATED 1	UniProtKB/Swiss-Prot
Pfam	zf-C2H2	UniProtKB/Swiss-Prot
PhenoGen	Osr1	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/Swiss-Prot
	ZINC_FINGER_C2H2_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000004210	RatGTEx
SMART	ZnF_C2H2	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57667	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZZT8_RAT	UniProtKB/TrEMBL
	A0A8L2Q278	ENTREZGENE, UniProtKB/TrEMBL
	B0K011	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-12-04	Osr1	odd-skipped related transcription factor 1	Osr1	odd-skipped related transciption factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-11-19	Osr1	odd-skipped related transciption factor 1	Osr1	odd-skipped related 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Osr1	odd-skipped related 1 (Drosophila)	Osr1_predicted	odd-skipped related 1 (Drosophila) (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Osr1_predicted	odd-skipped related 1 (Drosophila) (predicted)			Symbol and Name updated	1299863	APPROVED
2006-03-28	Osr1_predicted		Odd1_predicted	odd-skipped related 1 (Drosophila) (predicted)	Symbol updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-01-12	Odd1_predicted	odd-skipped related 1 (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message