Advanced Search (OLGA)

Gene: Cdc73 (cell division cycle 73) Rattus norvegicus

Analyze

Symbol:

Cdc73

Name:

cell division cycle 73

RGD ID:

1311766

Description:

Predicted to enable RNA polymerase II complex binding activity. Predicted to be involved in several processes, including negative regulation of cell population proliferation; regulation of RNA metabolic process; and regulation of cell cycle G1/S phase transition. Predicted to act upstream of or within negative regulation of apoptotic process; regulation of cell growth; and regulation of transcription by RNA polymerase II. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of Cdc73/Paf1 complex. Human ortholog(s) of this gene implicated in hyperparathyroidism and parathyroid carcinoma. Orthologous to human CDC73 (cell division cycle 73); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase II transcription elongation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cell division cycle 73, Paf1/RNA polymerase II complex component, homolog; cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae); cell division cycle protein 73 homolog; Hrpt2; hyperparathyroidism 2 (with jaw tumor); hyperparathyroidism 2 protein homolog; LOC304832; parafibromin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDC73 (cell division cycle 73)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cdc73 (cell division cycle 73, Paf1/RNA polymerase II complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cdc73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDC73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDC73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cdc73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDC73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDC73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cdc73 (cell division cycle 73)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GALNT9 (polypeptide N-acetylgalactosaminyltransferase 9)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CDC73 (cell division cycle 73)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cdc73 (cell division cycle 73, Paf1/RNA polymerase II complex component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cdc73 (cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC73	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdc-73	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	hyx	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdc73	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	57,897,924 - 58,000,031 (-)	NCBI		GRCr8
mRatBN7.2	13	55,357,226 - 55,449,690 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	55,357,226 - 55,449,656 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	57,920,582 - 58,012,922 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	59,192,881 - 59,285,299 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	56,477,724 - 56,570,082 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	60,403,771 - 60,496,511 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	60,403,771 - 60,496,511 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	65,392,579 - 65,485,175 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	57,441,674 - 57,534,385 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	57,455,753 - 57,548,465 (-)	NCBI
Celera	13	55,444,707 - 55,537,113 (-)	NCBI		Celera
Cytogenetic Map	13	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

breast cancer (ISO)

Breast Cancer, Familial (ISO)

colorectal cancer (ISO)

Familial Cystic Parathyroid Adenomatosis (ISO)

gastric adenocarcinoma (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

head and neck squamous cell carcinoma (ISO)

Hereditary Neoplastic Syndromes (ISO)

hyperparathyroidism (ISO,ISS)

Hyperparathyroidism 1 (ISO)

Hyperparathyroidism 2 (ISO)

laryngeal squamous cell carcinoma (ISO)

lung adenocarcinoma (ISO)

lung cancer (ISO)

multiple endocrine neoplasia type 1 (ISO)

oral squamous cell carcinoma (ISO)

ossifying fibroma (ISO)

ovarian cancer (ISO)

parathyroid adenoma (ISO)

Parathyroid Cancer (ISO)

parathyroid carcinoma (ISO)

Parathyroid Neoplasms (ISO)

stomach cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

aflatoxin B1 (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

crocidolite asbestos (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

enzyme inhibitor (ISO)

flutamide (EXP)

FR900359 (ISO)

gentamycin (EXP)

ivermectin (ISO)

methapyrilene (ISO)

mono(2-ethylhexyl) phthalate (ISO)

nefazodone (EXP)

paclitaxel (ISO)

phenobarbital (ISO)

potassium chromate (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

resveratrol (EXP)

rimonabant (ISO)

selenium atom (ISO)

sodium arsenite (EXP,ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

troglitazone (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to lipopolysaccharide (IEA,ISO,ISS)

endodermal cell fate commitment (IEA,ISO,ISS)

mRNA 3'-end processing (ISO,ISS)

negative regulation of apoptotic process (IEA,ISO)

negative regulation of cell population proliferation (ISO,ISS)

negative regulation of epithelial cell proliferation (ISO)

negative regulation of fibroblast proliferation (ISO)

negative regulation of G1/S transition of mitotic cell cycle (ISO,ISS)

negative regulation of myeloid cell differentiation (ISO,ISS)

negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS)

positive regulation of cell cycle G1/S phase transition (ISO,ISS)

positive regulation of mRNA 3'-end processing (ISO,ISS)

positive regulation of transcription by RNA polymerase II (ISO)

positive regulation of transcription elongation by RNA polymerase II (IBA)

positive regulation of Wnt signaling pathway (ISO,ISS)

protein destabilization (ISO)

regulation of cell growth (IEA,ISO)

regulation of transcription by RNA polymerase II (IEA,ISO)

stem cell population maintenance (IEA,ISO,ISS)

transcription elongation by RNA polymerase II (IEA,ISO,ISS)

Wnt signaling pathway (IEA)

Cellular Component

Cdc73/Paf1 complex (IBA,IEA,ISO,ISS)

cytosol (ISO)

nucleoplasm (ISO)

nucleus (IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

RNA polymerase II complex binding (IBA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase I transcription pathway (ISO)

RNA polymerase II transcription elongation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	HRPT2, encoding parafibromin, is mutated in hyperparathyroidism-jaw tumor syndrome.	Carpten JD, etal., Nat Genet. 2002 Dec;32(4):676-80. Epub 2002 Nov 18.
2.	Significance of Parafibromin Expression in Laryngeal Squamous Cell Carcinomas.	Cho I, etal., J Pathol Transl Med. 2016 Jul;50(4):264-9. doi: 10.4132/jptm.2016.04.24. Epub 2016 Jun 23.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Parafibromin, APC, and MIB-1 Are Useful Markers for Distinguishing Parathyroid Carcinomas From Adenomas.	Hosny Mohammed K, etal., Appl Immunohistochem Mol Morphol. 2017 Nov/Dec;25(10):731-735. doi: 10.1097/PAI.0000000000000378.
5.	The Paf1 complex: platform or player in RNA polymerase II transcription?	Jaehning JA Biochim Biophys Acta. 2010 May-Jun;1799(5-6):379-88. doi: 10.1016/j.bbagrm.2010.01.001. Epub 2010 Jan 12.
6.	Transcriptional repression of tumor suppressor CDC73, encoding an RNA polymerase II interactor, by Wilms tumor 1 protein (WT1) promotes cell proliferation: implication for cancer therapeutics.	Rather MI, etal., J Biol Chem. 2014 Jan 10;289(2):968-76. doi: 10.1074/jbc.M113.483255. Epub 2013 Nov 20.
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Comprehensive gene review and curation	RGD comprehensive gene curation
11.	Somatic and germ-line mutations of the HRPT2 gene in sporadic parathyroid carcinoma.	Shattuck TM, etal., N Engl J Med. 2003 Oct 30;349(18):1722-9.
12.	Parafibromin expression in lung normal tissue and carcinoma: its comparison with clinicopathological parameters of carcinoma.	Xia P, etal., Histol Histopathol. 2011 Aug;26(8):1039-47. doi: 10.14670/HH-26.1039.
13.	The clinicopathological significances and biological functions of parafibromin expression in head and neck squamous cell carcinomas.	Zhang Z, etal., Tumour Biol. 2015 Dec;36(12):9487-97. doi: 10.1007/s13277-015-3618-5. Epub 2015 Jul 1.
14.	Parafibromin expression is an independent prognostic factor for colorectal carcinomas.	Zheng HC, etal., Hum Pathol. 2011 Aug;42(8):1089-102. doi: 10.1016/j.humpath.2010.10.024. Epub 2011 Feb 11.

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:15923622	PMID:16307923	PMID:16630820	PMID:16989776	PMID:17911113	PMID:18212049	PMID:18987311	PMID:19135898	PMID:19136632	PMID:19345177
PMID:20178742	PMID:20541477	PMID:21329879	PMID:31505169

Genomics

Comparative Map Data

Cdc73
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	57,897,924 - 58,000,031 (-)	NCBI		GRCr8
mRatBN7.2	13	55,357,226 - 55,449,690 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	55,357,226 - 55,449,656 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	57,920,582 - 58,012,922 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	59,192,881 - 59,285,299 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	56,477,724 - 56,570,082 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	60,403,771 - 60,496,511 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	60,403,771 - 60,496,511 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	65,392,579 - 65,485,175 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	57,441,674 - 57,534,385 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	57,455,753 - 57,548,465 (-)	NCBI
Celera	13	55,444,707 - 55,537,113 (-)	NCBI		Celera
Cytogenetic Map	13	q21	NCBI

CDC73
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	193,122,031 - 193,254,815 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	193,121,983 - 193,254,815 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	193,091,161 - 193,223,945 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	191,357,784 - 191,487,679 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	189,822,817 - 189,952,713	NCBI
Celera	1	166,200,694 - 166,333,560 (+)	NCBI		Celera
Cytogenetic Map	1	q31.2	NCBI
HuRef	1	164,326,911 - 164,459,852 (+)	NCBI		HuRef
CHM1_1	1	194,512,977 - 194,645,669 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	192,469,240 - 192,602,060 (+)	NCBI		T2T-CHM13v2.0

Cdc73
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	143,479,014 - 143,578,631 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	143,474,538 - 143,578,631 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	143,603,276 - 143,702,893 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	143,598,800 - 143,702,893 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	145,454,629 - 145,549,814 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	145,369,717 - 145,464,902 (-)	NCBI		MGSCv36	mm8
Celera	1	146,186,403 - 146,281,769 (-)	NCBI		Celera
Cytogenetic Map	1	F	NCBI
cM Map	1	62.52	NCBI

Cdc73
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	30,533,060 - 30,665,812 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	30,533,919 - 30,665,812 (+)	NCBI	ChiLan1.0	ChiLan1.0

CDC73
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	56,534,616 - 56,670,750 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	56,190,589 - 56,334,645 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	168,581,730 - 168,710,915 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	172,875,365 - 173,004,942 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	172,875,365 - 173,004,934 (+)	Ensembl	panpan1.1		panPan2

CDC73
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	5,826,209 - 5,937,930 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	5,805,916 - 5,938,111 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	5,923,156 - 6,034,975 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	5,842,156 - 5,954,484 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	5,841,856 - 5,954,492 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	5,841,710 - 5,953,973 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	6,206,980 - 6,319,388 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	6,435,831 - 6,547,946 (-)	NCBI		UU_Cfam_GSD_1.0

Cdc73
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	80,662,470 - 80,779,375 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936638	1,365,648 - 1,483,277 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936638	1,365,457 - 1,482,497 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDC73
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	575,075 - 667,432 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	575,075 - 667,618 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	2,279,054 - 2,305,137 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDC73
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	36,167,482 - 36,302,918 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	36,170,134 - 36,302,812 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	37,127,006 - 37,251,142 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdc73
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624814	299,444 - 460,391 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624814	298,015 - 460,314 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cdc73
300 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	27
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000004495
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
6893344	Cm79	Cardiac mass QTL 79	1.5	0.04	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	43720770	62022792	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	22301875	67301875	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	14915655	59915655	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
70170	Eae14	Experimental allergic encephalomyelitis QTL 14		0.0024	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	23203448	68203448	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	23692969	68692969	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	31241331	58363171	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	23692969	68692969	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	15158722	60158722	Rat

Markers in Region

RH142331

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	55,357,192 - 55,357,392 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	60,403,738 - 60,403,937	NCBI	Rnor6.0
Rnor_5.0	13	65,392,546 - 65,392,745	UniSTS	Rnor5.0
RGSC_v3.4	13	57,441,641 - 57,441,840	UniSTS	RGSC3.4
Celera	13	55,444,674 - 55,444,873	UniSTS
Cytogenetic Map	13	q21	UniSTS

RH142465

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	55,396,472 - 55,396,616 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	60,443,011 - 60,443,154	NCBI	Rnor6.0
Rnor_5.0	13	65,431,675 - 65,431,818	UniSTS	Rnor5.0
RGSC_v3.4	13	57,481,196 - 57,481,339	UniSTS	RGSC3.4
Celera	13	55,483,931 - 55,484,074	UniSTS
Cytogenetic Map	13	q21	UniSTS

UniSTS:495935

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	55,395,168 - 55,395,782 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	60,441,707 - 60,442,320	NCBI	Rnor6.0
Rnor_5.0	13	65,430,371 - 65,430,984	UniSTS	Rnor5.0
RGSC_v3.4	13	57,479,892 - 57,480,505	UniSTS	RGSC3.4
Celera	13	55,482,627 - 55,483,240	UniSTS
Cytogenetic Map	13	q21	UniSTS

B3galt2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	55,394,689 - 55,395,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	60,441,228 - 60,441,651	NCBI	Rnor6.0
Rnor_5.0	13	65,429,892 - 65,430,315	UniSTS	Rnor5.0
Celera	13	55,482,148 - 55,482,571	UniSTS
Cytogenetic Map	13	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090729	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097445	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004495 ⟹ ENSRNOP00000004495

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	55,357,226 - 55,449,656 (-)	Ensembl
Rnor_6.0 Ensembl	13	60,403,771 - 60,496,511 (-)	Ensembl

RefSeq Acc Id:

NM_001024769 ⟹ NP_001019940

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	57,907,543 - 57,999,978 (-)	NCBI
mRatBN7.2	13	55,357,226 - 55,449,656 (-)	NCBI
Rnor_6.0	13	60,403,771 - 60,496,511 (-)	NCBI
Rnor_5.0	13	65,392,579 - 65,485,175 (-)	NCBI
RGSC_v3.4	13	57,441,674 - 57,534,385 (-)	RGD
Celera	13	55,444,707 - 55,537,113 (-)	RGD

Sequence:

show sequence

GGTGGCTGTTGGTTCGCGGCGGCGGCGGCGGGGGAAGAGGGCGAGGCGACGGGGAAAGGAGGCG
GCGGGCGCGGCGGCGACGGCGGTGCCCGGGGCCCGCGGCGGCGGCGGCTGTAGCAGCGAGGGGG
GCGAAGATGGCGGACGTGCTCAGCGTCCTGCGACAGTACAACATCCAGAAGAAGGAGATTGTGG
TCAAGGGGGATGAAGTGATCTTCGGGGAGTTCTCCTGGCCCAAGAATGTGAAGACCAACTATGT
AGTTTGGGGGACCGGAAAGGAAGGCCAACCCAGAGAATACTACACATTGGATTCTATCCTATTT
CTCCTTAATAATGTGCACCTTTCGCATCCTGTTTATGTCCGACGTGCAGCTACTGAAAATATTC
CTGTGGTTAGAAGACCTGACAGAAAGGATCTCCTTGGATATCTCAATGGGGAAGCATCAACATC
AGCAAGCATAGACAGGAGTGCCCCCCTGGAAATAGGTCTTCAGCGGTCTACTCAAGTCAAAAGA
GCTGCAGATGAAGTTTTAGCAGAAGCAAAGAAACCACGAATTGAGGATGAAGAGTGTGTGCGCC
TTGATAAAGAGAGATTGGCAGCCCGTTTGGAAGGCCATAAAGAAGGAATCGTGCAGACTGAACA
GATTAGGTCTTTATCTGAAGCCATGTTAGTGGAAAAAATTGCTGCAATCAAAGCCAAAATTATG
GCTAAGAAAAGATCTACTATCAAGACCGATCTAGATGATGATATAACTGCCCTTAAGCAGAGGA
GTTTTGTGGATGCTGAGGTAGATGTGACCAGAGATATTGTCAGCAGAGAGAGAGTATGGCGGAC
AAGAACAACTATCTTACAGAGCACAGGAAAGAATTTTTCAAAGAATATTTTCGCAATTCTTCAA
TCAGTAAAAGCCAGAGAAGAAGGGCGTGCCCCCGAACAACGGCCAGCTCCAAATGCAGCCCCTG
TGGATCCTACATTGCGTACAAAACAGCCTATTCCAGCTGCCTACAACAGATATGACCAAGAAAG
ATTCAAAGGCAAAGAAGAAACGGAAGGTTTTAAGATCGATACTATGGGTACCTACCATGGCATG
ACGCTGAAATCTGTCACGGAAGGTGCATCTGCCCGTAAGACTCAAACTCCTGCAGCCCAGCCTG
TACCTAGACCAGTGTCTCAAGCAAGACCTCCCCCAAATCAGAAGAAAGGGTCTCGAACACCCAT
CATTATTATTCCTGCAGCTACCACTTCTTTAATAACCATGCTTAATGCAAAAGACCTTCTACAG
GATCTGAAATTTGTCCCATCAGATGAAAAGAAGAAACAGGGATGTCAACGAGAAAATGAAACAC
TAATACAGAGAAGAAAAGACCAGATGCAACCTGGGGGCACAGCAATTAGTGTCACAGTCCCTTA
CAGAGTAGTAGACCAGCCTCTGAAGCTTATGCCTCAAGACTGGGATCGAGTCGTAGCTGTTTTT
GTACAAGGTCCTGCTTGGCAGTTCAAAGGTTGGCCATGGCTTCTACCTGATGGATCACCAGTTG
ACATATTTGCAAAAATTAAAGCCTTCCATCTCAAGTATGATGAAGTTCGTCTAGATCCAAATGT
TCAAAAATGGGATGTAACAGTATTAGAACTCAGCTATCATAAACGTCATTTGGATAGACCAGTT
TTCTTACGTTTCTGGGAAACATTGGATAGATACATGGTAAAGCACAAATCCCACTTGAGATTCT
GAATCATTTAATTCCTCCTTTTCTGAAAACTTGGATTAAGAAGCATGGATATAGCTTGATCTAC
AGACTGAAACCAAGCTTTATGAATTCATCAAGAACTTGTAAATGAAGAAGGACACAGAGTAGTC
TTTTATAAGACCTTGTTTGATGCTGTGTGCTTCAAAGGGGCAATGCCTCCCATCCATACAAGCA
AACTTTTTTGGCTTACAACTATTTTTTTAATATTAGCCTTCTAGTCTGTAATGGAAATTGTATA
TTTTGATAGAAGTTTTTTCTCTATTGGTTAAATTAGCATTACTTAAAATTTGTTTCTTTAGAAA
TAAATACAGGTTATAAATGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039090729 ⟹ XP_038946657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	57,917,418 - 58,000,031 (-)	NCBI
mRatBN7.2	13	55,365,839 - 55,449,690 (-)	NCBI

RefSeq Acc Id:

XM_063272314 ⟹ XP_063128384

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	57,897,924 - 57,976,488 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019940	(Get FASTA)	NCBI Sequence Viewer
	XP_038946657	(Get FASTA)	NCBI Sequence Viewer
	XP_063128384	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97445	(Get FASTA)	NCBI Sequence Viewer
	EDM09609	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004495
GenBank Protein	Q4V8C8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001019940 ⟸ NM_001024769

- UniProtKB:

Q4V8C8 (UniProtKB/Swiss-Prot), A6ICN7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADVLSVLRQYNIQKKEIVVKGDEVIFGEFSWPKNVKTNYVVWGTGKEGQPREYYTLDSILFLL
NNVHLSHPVYVRRAATENIPVVRRPDRKDLLGYLNGEASTSASIDRSAPLEIGLQRSTQVKRAA
DEVLAEAKKPRIEDEECVRLDKERLAARLEGHKEGIVQTEQIRSLSEAMLVEKIAAIKAKIMAK
KRSTIKTDLDDDITALKQRSFVDAEVDVTRDIVSRERVWRTRTTILQSTGKNFSKNIFAILQSV
KAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTL
KSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDL
KFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQ
GPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFL
RFWETLDRYMVKHKSHLRF

hide sequence

Ensembl Acc Id:

ENSRNOP00000004495 ⟸ ENSRNOT00000004495

RefSeq Acc Id:	XP_038946657 ⟸ XM_039090729
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063128384 ⟸ XM_063272314
- Peptide Label:	isoform X2

Protein Domains

Cell division control protein 73 C-terminal Paf1 complex subunit Cdc73 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V8C8-F1-model_v2	AlphaFold	Q4V8C8	1-531	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698871

Promoter ID:

EPDNEW_R9396

Type:

initiation region

Name:

Cdc73_1

Description:

cell division cycle 73

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	60,496,557 - 60,496,617	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311766	AgrOrtholog
BioCyc Gene	G2FUF-18032	BioCyc
Ensembl Genes	ENSRNOG00000003258	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000004495	ENTREZGENE
Gene3D-CATH	3.40.50.11990	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7456471	IMAGE-MGC_LOAD
InterPro	Cdc73/Parafibromin	UniProtKB/Swiss-Prot
	CDC73_C	UniProtKB/Swiss-Prot
	CDC73_C_sf	UniProtKB/Swiss-Prot
	Cdc73_N	UniProtKB/Swiss-Prot
KEGG Report	rno:304832	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114504	IMAGE-MGC_LOAD
NCBI Gene	304832	ENTREZGENE
PANTHER	PARAFIBROMIN	UniProtKB/Swiss-Prot
	PTHR12466	UniProtKB/Swiss-Prot
Pfam	CDC73_C	UniProtKB/Swiss-Prot
	CDC73_N	UniProtKB/Swiss-Prot
PhenoGen	Cdc73	PhenoGen
RatGTEx	ENSRNOG00000003258	RatGTEx
UniProt	A6ICN7	ENTREZGENE, UniProtKB/TrEMBL
	CDC73_RAT	UniProtKB/Swiss-Prot
	F2Z3T0_RAT	UniProtKB/TrEMBL
	Q4V8C8	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-01-23	Cdc73	cell division cycle 73	Cdc73	cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-06-27			Cdc73	cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Cdc73	cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)	Hrpt2	hyperparathyroidism 2 (with jaw tumor)	Symbol and Name updated	1299863	APPROVED
2005-12-06	Hrpt2	hyperparathyroidism 2 (with jaw tumor)	Hrpt2_predicted	hyperparathyroidism 2 (with jaw tumor) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Hrpt2_predicted	hyperparathyroidism 2 (with jaw tumor) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations