Mesp1 (mesoderm posterior bHLH transcription factor 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mesp1 (mesoderm posterior bHLH transcription factor 1) Rattus norvegicus

Analyze

Symbol:

Mesp1

Name:

mesoderm posterior bHLH transcription factor 1

RGD ID:

1311751

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in several processes, including heart development; negative regulation of cell fate specification; and regulation of DNA-templated transcription. Predicted to act upstream of or within several processes, including cardioblast migration; mesodermal cell migration; and signal transduction involved in regulation of gene expression. Predicted to be located in nucleus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human MESP1 (mesoderm posterior bHLH transcription factor 1); INTERACTS WITH 6-propyl-2-thiouracil; bisphenol A; cefaloridine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC308766; mesoderm posterior 1 ; mesoderm posterior 1 homolog; mesoderm posterior 1 homolog (mouse); mesoderm posterior basic helix-loop-helix transcription factor 1; mesoderm posterior protein 1

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MESP1 (mesoderm posterior bHLH transcription factor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mesp1 (mesoderm posterior 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MESP1 (mesoderm posterior bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MESP1 (mesoderm posterior bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mesp1 (mesoderm posterior bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MESP1 (mesoderm posterior bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MESP1 (mesoderm posterior bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MESP2 (mesoderm posterior bHLH transcription factor 2)	HGNC	OrthoDB
Homo sapiens (human):	CBX8 (chromobox 8)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Mesp1 (mesoderm posterior 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MESP1 (mesoderm posterior bHLH transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mespab (mesoderm posterior ab)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	mespbb (mesoderm posterior bb)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	mespaa (mesoderm posterior aa)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	mespba (mesoderm posterior ba)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sage	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mespb	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mespa	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	133,738,357 - 133,739,875 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	133,738,357 - 133,739,875 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	141,647,506 - 141,649,024 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	148,816,911 - 148,818,429 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	141,734,607 - 141,736,125 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	141,532,390 - 141,533,908 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	141,532,390 - 141,533,908 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	142,493,452 - 142,494,970 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	135,571,777 - 135,573,295 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	135,650,456 - 135,651,437 (-)	NCBI
Celera	1	125,801,663 - 125,803,181 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

congenital heart disease (ISO)

D-2-hydroxyglutaric aciduria 2 (ISO)

diabetic retinopathy (ISO)

genetic disease (ISO)

myocardial infarction (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzylpenicillin (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium atom (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

cefaloridine (EXP)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dorsomorphin (ISO)

folic acid (ISO)

L-methionine (ISO)

lead(0) (ISO)

leflunomide (ISO)

lithium chloride (ISO)

Monobutylphthalate (ISO)

niclosamide (ISO)

ozone (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

phenytoin (ISO)

resveratrol (ISO)

rotenone (ISO)

saccharin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

temozolomide (ISO)

tetrachloroethene (ISO)

tetraphene (ISO)

thapsigargin (ISO)

tributylstannane (EXP)

trichloroethene (EXP)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cardiac atrium formation (ISO)

cardiac cell fate determination (ISO)

cardiac muscle cell differentiation (ISO)

cardiac vascular smooth muscle cell differentiation (ISO)

cardiac ventricle formation (ISO)

cardioblast anterior-lateral migration (ISO)

cardioblast migration (ISO)

cardioblast migration to the midline involved in heart field formation (ISO)

embryonic heart tube morphogenesis (ISO)

endothelial cell differentiation (ISO)

gastrulation (ISO)

gene expression (ISO)

growth involved in heart morphogenesis (ISO)

heart induction (IEA,ISO)

heart looping (ISO)

heart morphogenesis (IBA,ISO)

lateral mesoderm development (ISO)

mesoderm formation (IBA)

mesodermal cell migration (ISO)

negative regulation of canonical Wnt signaling pathway (ISO)

negative regulation of DNA-templated transcription (ISO)

negative regulation of endodermal cell fate specification (ISO)

negative regulation of mesodermal cell fate specification (ISO)

neurogenesis (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of hepatocyte differentiation (ISO)

positive regulation of Notch signaling pathway (ISO)

positive regulation of striated muscle cell differentiation (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

secondary heart field specification (ISO)

signal transduction involved in regulation of gene expression (ISO)

sinoatrial node cell differentiation (ISO)

sinus venosus morphogenesis (ISO)

somite rostral/caudal axis specification (IBA)

Cellular Component

cellular_component (ND)

nucleus (IBA,ISO)

Molecular Function

cis-regulatory region sequence-specific DNA binding (ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

molecular_function (ND)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

transcription cis-regulatory region binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Alterations of 5-hydroxymethylcytosines in circulating cell-free DNA reflect retinopathy in type 2 diabetes.	Han L, etal., Genomics. 2021 Jan;113(1 Pt 1):79-87. doi: 10.1016/j.ygeno.2020.11.014. Epub 2020 Nov 20.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	Homozygous MESP1 knock-in reporter hESCs facilitated cardiovascular cell differentiation and myocardial infarction repair.	Wang L, etal., Theranostics. 2020 May 23;10(15):6898-6914. doi: 10.7150/thno.42347. eCollection 2020.

Additional References at PubMed

PMID:8787751	PMID:10393122	PMID:18297060	PMID:18462699	PMID:18593560	PMID:23352431

Genomics

Comparative Map Data

Mesp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	133,738,357 - 133,739,875 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	133,738,357 - 133,739,875 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	141,647,506 - 141,649,024 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	148,816,911 - 148,818,429 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	141,734,607 - 141,736,125 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	141,532,390 - 141,533,908 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	141,532,390 - 141,533,908 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	142,493,452 - 142,494,970 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	135,571,777 - 135,573,295 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	135,650,456 - 135,651,437 (-)	NCBI
Celera	1	125,801,663 - 125,803,181 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

MESP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	89,732,446 - 89,751,249 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	89,749,875 - 89,751,249 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	90,293,106 - 90,294,480 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	88,094,110 - 88,095,552 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	66,695,858 - 66,697,300 (-)	NCBI		Celera
Cytogenetic Map	15	q26.1	NCBI
HuRef	15	66,406,054 - 66,407,496 (-)	NCBI		HuRef
CHM1_1	15	90,133,926 - 90,135,368 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	87,488,329 - 87,507,126 (-)	NCBI		T2T-CHM13v2.0

Mesp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	79,441,989 - 79,443,338 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	79,441,989 - 79,443,536 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	79,792,241 - 79,793,590 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	79,792,241 - 79,793,788 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	86,937,127 - 86,938,476 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	79,665,760 - 79,667,119 (-)	NCBI		MGSCv36	mm8
Celera	7	77,191,445 - 77,192,794 (-)	NCBI		Celera
Cytogenetic Map	7	D2	NCBI
cM Map	7	45.16	NCBI

MESP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	15	83,001,684 - 83,003,058 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	68,440,626 - 68,441,935 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	87,645,768 - 87,647,210 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	87,645,768 - 87,647,210 (-)	Ensembl	panpan1.1		panPan2

MESP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	52,738,333 - 52,739,962 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	52,738,366 - 52,739,755 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	55,372,284 - 55,373,854 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	53,155,122 - 53,156,692 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	53,155,145 - 53,156,534 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	52,676,925 - 52,678,493 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	52,886,866 - 52,888,431 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	53,227,220 - 53,228,790 (-)	NCBI		UU_Cfam_GSD_1.0

Mesp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	130,799,944 - 130,801,262 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	15,533,522 - 15,534,576 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	15,533,264 - 15,534,576 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MESP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	55,322,274 - 55,323,539 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	55,322,016 - 55,327,600 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	60,211,078 - 60,218,711 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MESP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	8,286,551 - 8,288,777 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	8,286,828 - 8,287,918 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	38,523,729 - 38,525,347 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	200
Count of miRNA genes:	146
Interacting mature miRNAs:	164
Transcripts:	ENSRNOT00000020117
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123479780	142990467	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat

Markers in Region

BE108635

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	133,738,362 - 133,738,541 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	141,532,396 - 141,532,574	NCBI	Rnor6.0
Rnor_5.0	1	142,493,458 - 142,493,636	UniSTS	Rnor5.0
RGSC_v3.4	1	135,571,783 - 135,571,961	UniSTS	RGSC3.4
Celera	1	125,801,669 - 125,801,847	UniSTS
RH 3.4 Map	1	1062.9	UniSTS
Cytogenetic Map	1	q31	UniSTS

Mesp1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	133,738,513 - 133,739,672 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	141,532,547 - 141,533,705	NCBI	Rnor6.0
Rnor_5.0	1	142,493,609 - 142,494,767	UniSTS	Rnor5.0
Celera	1	125,801,820 - 125,802,978	UniSTS
Cytogenetic Map	1	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	endocrine system	hemolymphoid system	integumental system	musculoskeletal system	nervous system	reproductive system	respiratory system	appendage
High
Medium
Low					12	5	2
Below cutoff	6	4	2	3	35	5	7	2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000020117 ⟹ ENSRNOP00000020117

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	133,738,357 - 133,739,875 (-)	Ensembl
Rnor_6.0 Ensembl	1	141,532,390 - 141,533,908 (-)	Ensembl

RefSeq Acc Id:

NM_001107531 ⟹ NP_001101001

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	133,738,357 - 133,739,875 (-)	NCBI
Rnor_6.0	1	141,532,390 - 141,533,908 (-)	NCBI
Rnor_5.0	1	142,493,452 - 142,494,970 (-)	NCBI
RGSC_v3.4	1	135,571,777 - 135,573,295 (-)	RGD
Celera	1	125,801,663 - 125,803,181 (-)	RGD

Sequence:

show sequence

ACTTGCAGGGCTGGCTTAACACCCTGGACACCGCAGGCTTTAGGTGCCTGTCTTACTGATGCCC
CATCTATGGCCTAGGTGGAGCAAACTGGACCAAGGGGTCCTGCACCTAAGAGCCCCTGCTCTTG
GTTCAAAGGGTTCAAGCCCTGCCCCCCTCCAGGCTCGAGCCGGCTTTGATGTGCTGATGAGTTC
TGGAAGGGGCCGCTTCACACCTAGGGCTCCGGATAAAGCTGCAGCGGACCCAATGGTCAGGCCT
CCGCTGCCATGGCCCAGCCCCTGTGCGCGCCACTCTCCAAGTCCTGGATCCCGAGTCCCGCTCG
TCCGCAGCCATCGATGCCTTCCGATGGGGACAGCTTCTGCTCCCCAGCCTGGTCCTCGGACTCG
TGGGACGGTGCCCAGGCCAGCAGCCCTGCACTACCCTGTGCCCGCCCGGCCCGGCGTGCTGGGA
CCCCCGGTAGGCGCGGGACGCATGGCAGCCGCCTGGGTAGCGGACAGCGGCAGAGCGCCAGCGA
ACGCGAGAAGCTTCGTATGCGCACGCTCGCCCGCGCGCTGCACGAGCTGCGCCGCTTCTTGCCT
CCTTCAGTGGCACCAATCGGCCAGAACCTGACCAAGATCGAGACGCTGCGCCTGGCCATCCGCT
ACATCGGCCACCTGTCGGCTGTGCTGGGCCTCAGCGAGGACAGCCTCCGGCAACAGCGACACGC
GGTGTCACCTCGAGGCTGCCCGCTGTGCCCCGACAGCGGCCTGGCGCAGGCGCAGTCTCTCGGT
CCCCATTTAAGCCCGGTTGCCTGCAGCGGGGTGTCCTGGGGTTCTTCGCCCGCCTACCCTAGAC
CCCGGGTCGCCGCAGAATCGTGGGACCCATCATTCCTGTACACCGAAACAGCATCCCTGGAAAG
GCAGGAGATGGAGCCCAGCCCCTCGTCTCCGCTCTTCAGCAGCGACATGCTGGCTCTGCTAGAA
ACCTGGACACCTCAGGAGTGGCCGCCAGCCTGAAGAGTTGAAGGGACAATGCAGTGGATGACTG
GCATCCTGTCTGAGCACAGACACTTTTCCTTTTGCCTTGGCACCTTCGAAGGGGGTATTTCCTG
GAAGAGGCACCAGTGATACCAACATGGGCGTCCCCGAGGTGGGAGCTGGTCCCCATCTAGACTG
TACCTTTCCAATCCTCCTTGGAAGGAGGGACCCAATGGGGTACACGCTCTAAAGCTGAAGCGGG
CACAAGTTCTGCCTGGTGTGTATTTATTTATTTGTGAATAAACCGTTTGTGCTAGTGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101001	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM08597	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020117
	ENSRNOP00000020117.2

RefSeq Acc Id:

NP_001101001 ⟸ NM_001107531

- UniProtKB:

D3ZUG3 (UniProtKB/TrEMBL), A6JC70 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAQPLCAPLSKSWIPSPARPQPSMPSDGDSFCSPAWSSDSWDGAQASSPALPCARPARRAGTPG
RRGTHGSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPIGQNLTKIETLRLAIRYIG
HLSAVLGLSEDSLRQQRHAVSPRGCPLCPDSGLAQAQSLGPHLSPVACSGVSWGSSPAYPRPRV
AAESWDPSFLYTETASLERQEMEPSPSSPLFSSDMLALLETWTPQEWPPA

hide sequence

RefSeq Acc Id:

ENSRNOP00000020117 ⟸ ENSRNOT00000020117

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZUG3-F1-model_v2	AlphaFold	D3ZUG3	1-242	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311751	AgrOrtholog
BioCyc Gene	G2FUF-58773	BioCyc
Ensembl Genes	ENSRNOG00000014951	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000020117	ENTREZGENE
	ENSRNOT00000020117.4	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
InterPro	HLH_DNA-bd	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
	Mesogenin/MesP	UniProtKB/TrEMBL
KEGG Report	rno:308766	UniProtKB/TrEMBL
NCBI Gene	308766	ENTREZGENE
PANTHER	MESODERM POSTERIOR PROTEIN 1	UniProtKB/TrEMBL
	PTHR20937	UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/TrEMBL
PhenoGen	Mesp1	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000014951	RatGTEx
SMART	HLH	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
UniProt	A6JC70	ENTREZGENE, UniProtKB/TrEMBL
	D3ZUG3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-06-26	Mesp1	mesoderm posterior bHLH transcription factor 1	Mesp1	mesoderm posterior basic helix-loop-helix transcription factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-07-10	Mesp1	mesoderm posterior basic helix-loop-helix transcription factor 1	Mesp1	mesoderm posterior 1 homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-12-15	Mesp1	mesoderm posterior 1 homolog (mouse)	Mesp1	mesoderm posterior 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Mesp1	mesoderm posterior 1	Mesp1_predicted	mesoderm posterior 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mesp1_predicted	mesoderm posterior 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar