Advanced Search (OLGA)

Gene: Steap1 (STEAP family member 1) Rattus norvegicus

Analyze

Symbol:

Steap1

Name:

STEAP family member 1

RGD ID:

1311543

Description:

Predicted to enable heme binding activity. Predicted to be located in endosome membrane. Predicted to be active in endosome and plasma membrane. Orthologous to several human genes including STEAP1 (STEAP family member 1); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC297738; metalloreductase STEAP1; six transmembrane epithelial antigen of the prostate; six transmembrane epithelial antigen of the prostate 1; Steap

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	29,231,809 - 29,242,317 (+)	NCBI		GRCr8
mRatBN7.2	4	28,276,972 - 28,287,484 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	28,276,909 - 28,287,479 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	33,259,056 - 33,269,580 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	29,185,120 - 29,195,644 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	27,571,914 - 27,582,416 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	25,435,885 - 25,446,393 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	25,435,873 - 25,446,461 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	25,343,985 - 25,354,493 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	24,962,598 - 24,973,106 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	24,966,530 - 24,973,107 (+)	NCBI
Celera	4	23,722,730 - 23,733,238 (+)	NCBI		Celera
Cytogenetic Map	4	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steap1	Rat	pleomorphic xanthoastrocytoma		ISO	RGD:1323057	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steap1	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of STEAP1 mRNA]	CTD	PMID:31150632
Steap1	Rat	(S)-nicotine	increases expression	ISO	RGD:1323057	6480464	Nicotine results in increased expression of STEAP1 mRNA	CTD	PMID:23825647
Steap1	Rat	1,1-dichloroethene	increases expression	ISO	RGD:1323058	6480464	vinylidene chloride results in increased expression of STEAP1 mRNA	CTD	PMID:26682919
Steap1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1323058	6480464	1,2-Dimethylhydrazine results in increased expression of STEAP1 mRNA	CTD	PMID:22206623
Steap1	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of STEAP1 mRNA	CTD	PMID:30723492
Steap1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1323057	6480464	Estradiol results in decreased expression of STEAP1 mRNA	CTD	PMID:16474171
Steap1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1323057	6480464	[Estradiol co-treated with TGFB1 protein] results in increased expression of STEAP1 mRNA	CTD	PMID:30165855
Steap1	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	increases expression	ISO	RGD:1323057	6480464	Metribolone results in increased expression of STEAP1 mRNA	CTD	PMID:17010196
Steap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1323058	6480464	Tetrachlorodibenzodioxin results in increased expression of STEAP1 mRNA	CTD	PMID:19770486
Steap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of STEAP1 mRNA	CTD	PMID:34747641
Steap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1323058	6480464	Tetrachlorodibenzodioxin results in decreased expression of STEAP1 mRNA	CTD	PMID:33956508
Steap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1323058	6480464	Tetrachlorodibenzodioxin affects the expression of STEAP1 mRNA	CTD	PMID:21570461\|PMID:28213091
Steap1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1323057	6480464	Tetrachlorodibenzodioxin affects the expression of STEAP1 mRNA	CTD	PMID:22298810
Steap1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1323058	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of STEAP1 mRNA	CTD	PMID:38648751
Steap1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of STEAP1 mRNA	CTD	PMID:28522335
Steap1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1323058	6480464	Fenretinide results in increased expression of STEAP1 mRNA	CTD	PMID:28973697
Steap1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of STEAP1 mRNA	CTD	PMID:24780913\|PMID:25825206
Steap1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of STEAP1 mRNA	CTD	PMID:30047161
Steap1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of STEAP1 mRNA	CTD	PMID:28959563
Steap1	Rat	acrylamide	decreases expression	ISO	RGD:1323058	6480464	Acrylamide results in decreased expression of STEAP1 mRNA	CTD	PMID:35032568
Steap1	Rat	aflatoxin B1	affects expression	ISO	RGD:1323057	6480464	Aflatoxin B1 affects the expression of STEAP1 protein	CTD	PMID:20106945
Steap1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1323057	6480464	Tretinoin results in decreased expression of STEAP1 mRNA	CTD	PMID:23724009\|PMID:33167477
Steap1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of STEAP1 mRNA	CTD	PMID:35163327
Steap1	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of STEAP1 mRNA	CTD	PMID:30047161
Steap1	Rat	antimycin A	decreases expression	ISO	RGD:1323057	6480464	Antimycin A results in decreased expression of STEAP1 mRNA	CTD	PMID:33512557
Steap1	Rat	arsane	multiple interactions	ISO	RGD:1323057	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STEAP1 more ...	CTD	PMID:39836092
Steap1	Rat	arsenic atom	multiple interactions	ISO	RGD:1323057	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STEAP1 more ...	CTD	PMID:39836092
Steap1	Rat	Azoxymethane	multiple interactions	ISO	RGD:1323058	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of STEAP1 more ...	CTD	PMID:29950665
Steap1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1323058	6480464	Benzo(a)pyrene results in increased expression of STEAP1 mRNA	CTD	PMID:20713471\|PMID:27195522
Steap1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1323057	6480464	Benzo(a)pyrene results in increased methylation of STEAP1 exon; Benzo(a)pyrene results in increased methylation of STEAP1 more ...	CTD	PMID:27901495
Steap1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1323058	6480464	Benzo(a)pyrene results in decreased expression of STEAP1 mRNA	CTD	PMID:19770486
Steap1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1323057	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of STEAP1 mRNA	CTD	PMID:20382639
Steap1	Rat	benzo[b]fluoranthene	decreases expression	ISO	RGD:1323058	6480464	benzo(b)fluoranthene results in decreased expression of STEAP1 mRNA	CTD	PMID:26377693
Steap1	Rat	beta-lapachone	increases expression	ISO	RGD:1323057	6480464	beta-lapachone results in increased expression of STEAP1 mRNA	CTD	PMID:38218311
Steap1	Rat	bisphenol A	decreases expression	ISO	RGD:1323057	6480464	bisphenol A results in decreased expression of STEAP1 mRNA	CTD	PMID:16474171
Steap1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of STEAP1 mRNA	CTD	PMID:25181051
Steap1	Rat	bisphenol A	increases expression	ISO	RGD:1323058	6480464	bisphenol A results in increased expression of STEAP1 mRNA	CTD	PMID:26063408
Steap1	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of STEAP1 promoter	CTD	PMID:22457795
Steap1	Rat	cadmium dichloride	increases expression	ISO	RGD:1323058	6480464	Cadmium Chloride results in increased expression of STEAP1 mRNA	CTD	PMID:24982889
Steap1	Rat	caffeine	decreases phosphorylation	ISO	RGD:1323057	6480464	Caffeine results in decreased phosphorylation of STEAP1 protein	CTD	PMID:35688186
Steap1	Rat	carbamazepine	affects expression	ISO	RGD:1323057	6480464	Carbamazepine affects the expression of STEAP1 mRNA	CTD	PMID:25979313
Steap1	Rat	carbon nanotube	increases expression	ISO	RGD:1323058	6480464	Nanotubes, Carbon analog results in increased expression of STEAP1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Steap1	Rat	chloroprene	increases expression	ISO	RGD:1323058	6480464	Chloroprene results in increased expression of STEAP1 mRNA	CTD	PMID:23125180
Steap1	Rat	choline	multiple interactions	ISO	RGD:1323058	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Steap1	Rat	chromium(6+)	affects expression	ISO	RGD:1323058	6480464	chromium hexavalent ion affects the expression of STEAP1 mRNA	CTD	PMID:28472532
Steap1	Rat	cisplatin	multiple interactions	ISO	RGD:1323057	6480464	[Cisplatin co-treated with panobinostat] affects the expression of STEAP1 mRNA	CTD	PMID:21791302
Steap1	Rat	cisplatin	affects response to substance	ISO	RGD:1323057	6480464	STEAP1 protein affects the susceptibility to Cisplatin	CTD	PMID:16217747
Steap1	Rat	cobalt dichloride	decreases expression	ISO	RGD:1323057	6480464	cobaltous chloride results in decreased expression of STEAP1 mRNA	CTD	PMID:19376846
Steap1	Rat	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of STEAP1 mRNA	CTD	PMID:24386269
Steap1	Rat	copper(II) chloride	increases expression	ISO	RGD:1323057	6480464	cupric chloride results in increased expression of STEAP1 mRNA	CTD	PMID:38568856
Steap1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1323057	6480464	Copper Sulfate results in decreased expression of STEAP1 mRNA	CTD	PMID:19549813
Steap1	Rat	crocidolite asbestos	increases expression	ISO	RGD:1323057	6480464	Asbestos, Crocidolite results in increased expression of STEAP1 mRNA	CTD	PMID:28056339
Steap1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of STEAP1 mRNA	CTD	PMID:26577399
Steap1	Rat	cyclosporin A	increases expression	ISO	RGD:1323057	6480464	Cyclosporine results in increased expression of STEAP1 mRNA	CTD	PMID:20106945\|PMID:33631201
Steap1	Rat	dextran sulfate	multiple interactions	ISO	RGD:1323058	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of STEAP1 more ...	CTD	PMID:29950665
Steap1	Rat	dicrotophos	decreases expression	ISO	RGD:1323057	6480464	dicrotophos results in decreased expression of STEAP1 mRNA	CTD	PMID:28302478
Steap1	Rat	dioxygen	decreases expression	ISO	RGD:1323057	6480464	Oxygen deficiency results in decreased expression of STEAP1 mRNA	CTD	PMID:26516004
Steap1	Rat	dioxygen	multiple interactions	ISO	RGD:1323058	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of STEAP1 mRNA	CTD	PMID:30529165
Steap1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Steap1	Rat	doxorubicin	decreases expression	ISO	RGD:1323057	6480464	Doxorubicin results in decreased expression of STEAP1 mRNA	CTD	PMID:29803840
Steap1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of STEAP1 mRNA	CTD	PMID:29391264
Steap1	Rat	entinostat	increases expression	ISO	RGD:1323057	6480464	entinostat results in increased expression of STEAP1 mRNA	CTD	PMID:26272509
Steap1	Rat	entinostat	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Steap1	Rat	ethyl methanesulfonate	decreases expression	ISO	RGD:1323057	6480464	Ethyl Methanesulfonate results in decreased expression of STEAP1 mRNA	CTD	PMID:23649840
Steap1	Rat	folic acid	multiple interactions	ISO	RGD:1323058	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Steap1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of STEAP1 mRNA	CTD	PMID:27387713
Steap1	Rat	genistein	decreases expression	ISO	RGD:1323057	6480464	Genistein results in decreased expression of STEAP1 mRNA	CTD	PMID:16474171
Steap1	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of STEAP1 mRNA	CTD	PMID:24395379
Steap1	Rat	gold atom	decreases expression	ISO	RGD:1323057	6480464	Gold results in decreased expression of STEAP1 mRNA	CTD	PMID:25523186
Steap1	Rat	gold(0)	decreases expression	ISO	RGD:1323057	6480464	Gold results in decreased expression of STEAP1 mRNA	CTD	PMID:25523186
Steap1	Rat	Heptachlor epoxide	increases expression	ISO	RGD:1323058	6480464	Heptachlor Epoxide results in increased expression of STEAP1 mRNA	CTD	PMID:25270620
Steap1	Rat	L-methionine	multiple interactions	ISO	RGD:1323058	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ...	CTD	PMID:20938992
Steap1	Rat	lead diacetate	affects expression	EXP		6480464	lead acetate affects the expression of STEAP1 mRNA	CTD	PMID:21864555
Steap1	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1323057	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of STEAP1 mRNA	CTD	PMID:35811015
Steap1	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of STEAP1 mRNA	CTD	PMID:28801915
Steap1	Rat	mercury dibromide	increases expression	ISO	RGD:1323057	6480464	mercuric bromide results in increased expression of STEAP1 mRNA	CTD	PMID:26272509
Steap1	Rat	mercury dibromide	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Steap1	Rat	methamphetamine	increases expression	EXP		6480464	Methamphetamine results in increased expression of STEAP1 mRNA	CTD	PMID:19564919
Steap1	Rat	methamphetamine	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in increased expression of STEAP1 mRNA	CTD	PMID:19564919
Steap1	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of STEAP1 mRNA	CTD	PMID:30047161
Steap1	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of STEAP1 gene	CTD	PMID:35440735
Steap1	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:1323057	6480464	Methyl Methanesulfonate results in decreased expression of STEAP1 mRNA	CTD	PMID:23649840
Steap1	Rat	nickel atom	increases expression	ISO	RGD:1323057	6480464	Nickel results in increased expression of STEAP1 mRNA	CTD	PMID:24768652\|PMID:25583101
Steap1	Rat	nicotine	increases expression	ISO	RGD:1323057	6480464	Nicotine results in increased expression of STEAP1 mRNA	CTD	PMID:23825647
Steap1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of STEAP1 mRNA	CTD	PMID:25729387
Steap1	Rat	ozone	increases expression	ISO	RGD:1323057	6480464	Ozone results in increased expression of STEAP1 mRNA	CTD	PMID:23033980
Steap1	Rat	ozone	multiple interactions	ISO	RGD:1323058	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Steap1	Rat	p-chloromercuribenzoic acid	increases expression	ISO	RGD:1323057	6480464	p-Chloromercuribenzoic Acid results in increased expression of STEAP1 mRNA	CTD	PMID:26272509
Steap1	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Steap1	Rat	panobinostat	multiple interactions	ISO	RGD:1323057	6480464	[Cisplatin co-treated with Panobinostat] affects the expression of STEAP1 mRNA; [NOG protein co-treated with Panobinostat more ...	CTD	PMID:21791302\|PMID:27188386
Steap1	Rat	paracetamol	affects expression	ISO	RGD:1323058	6480464	Acetaminophen affects the expression of STEAP1 mRNA	CTD	PMID:17562736
Steap1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of STEAP1 mRNA	CTD	PMID:33387578
Steap1	Rat	paracetamol	decreases expression	ISO	RGD:1323057	6480464	Acetaminophen results in decreased expression of STEAP1 mRNA	CTD	PMID:21420995
Steap1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of STEAP1 mRNA	CTD	PMID:32680482
Steap1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of STEAP1 mRNA	CTD	PMID:35163327
Steap1	Rat	phenylmercury acetate	increases expression	ISO	RGD:1323057	6480464	Phenylmercuric Acetate results in increased expression of STEAP1 mRNA	CTD	PMID:26272509
Steap1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Steap1	Rat	picoxystrobin	increases expression	ISO	RGD:1323057	6480464	picoxystrobin results in increased expression of STEAP1 mRNA	CTD	PMID:33512557
Steap1	Rat	potassium dichromate	increases expression	ISO	RGD:1323058	6480464	Potassium Dichromate results in increased expression of STEAP1 mRNA	CTD	PMID:23608068
Steap1	Rat	quercetin	decreases expression	ISO	RGD:1323057	6480464	Quercetin results in decreased expression of STEAP1 mRNA	CTD	PMID:21632981
Steap1	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1323057	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of STEAP1 mRNA	CTD	PMID:35811015
Steap1	Rat	SB 431542	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Steap1	Rat	SCH 23390	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in increased expression of STEAP1 mRNA	CTD	PMID:19564919
Steap1	Rat	SCH 23390	increases expression	EXP		6480464	SCH 23390 results in increased expression of STEAP1 mRNA	CTD	PMID:19564919
Steap1	Rat	silicon dioxide	decreases expression	ISO	RGD:1323057	6480464	Silicon Dioxide analog results in decreased expression of STEAP1 mRNA	CTD	PMID:25895662
Steap1	Rat	silicon dioxide	increases expression	ISO	RGD:1323058	6480464	Silicon Dioxide results in increased expression of STEAP1 mRNA	CTD	PMID:23221170
Steap1	Rat	sodium arsenite	decreases expression	ISO	RGD:1323057	6480464	sodium arsenite results in decreased expression of STEAP1 mRNA	CTD	PMID:20371982\|PMID:38568856
Steap1	Rat	sodium arsenite	decreases expression	ISO	RGD:1323058	6480464	sodium arsenite results in decreased expression of STEAP1 mRNA	CTD	PMID:37682722
Steap1	Rat	sodium arsenite	multiple interactions	ISO	RGD:1323057	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of STEAP1 more ...	CTD	PMID:39836092
Steap1	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of STEAP1 mRNA	CTD	PMID:30047161
Steap1	Rat	sulforaphane	increases expression	ISO	RGD:1323057	6480464	sulforaphane results in increased expression of STEAP1 mRNA	CTD	PMID:31838189
Steap1	Rat	temozolomide	decreases expression	ISO	RGD:1323057	6480464	Temozolomide results in decreased expression of STEAP1 mRNA	CTD	PMID:31758290
Steap1	Rat	tetrachloromethane	increases expression	ISO	RGD:1323058	6480464	Carbon Tetrachloride results in increased expression of STEAP1 mRNA	CTD	PMID:27339419\|PMID:31919559
Steap1	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of STEAP1 mRNA	CTD	PMID:31150632
Steap1	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of STEAP1 mRNA]	CTD	PMID:31150632
Steap1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of STEAP1 mRNA	CTD	PMID:34492290
Steap1	Rat	titanium dioxide	increases expression	ISO	RGD:1323058	6480464	titanium dioxide results in increased expression of STEAP1 mRNA	CTD	PMID:27760801
Steap1	Rat	titanium dioxide	increases methylation	ISO	RGD:1323058	6480464	titanium dioxide results in increased methylation of STEAP1 gene	CTD	PMID:35295148
Steap1	Rat	titanium dioxide	multiple interactions	ISO	RGD:1323058	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of STEAP1 more ...	CTD	PMID:29950665
Steap1	Rat	titanium dioxide	affects expression	ISO	RGD:1323058	6480464	titanium dioxide affects the expression of STEAP1 mRNA	CTD	PMID:23557971
Steap1	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in increased expression of STEAP1 mRNA	CTD	PMID:25729387
Steap1	Rat	trichostatin A	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Steap1	Rat	trichostatin A	increases expression	ISO	RGD:1323057	6480464	trichostatin A results in increased expression of STEAP1 mRNA	CTD	PMID:24935251\|PMID:26272509\|PMID:27188386
Steap1	Rat	trimellitic anhydride	increases expression	ISO	RGD:1323058	6480464	trimellitic anhydride results in increased expression of STEAP1 mRNA	CTD	PMID:19042947
Steap1	Rat	tris(2-butoxyethyl) phosphate	affects expression	ISO	RGD:1323057	6480464	tris(2-butoxyethyl) phosphate affects the expression of STEAP1 mRNA	CTD	PMID:29024780
Steap1	Rat	valproic acid	affects expression	ISO	RGD:1323057	6480464	Valproic Acid affects the expression of STEAP1 mRNA	CTD	PMID:25979313
Steap1	Rat	valproic acid	increases expression	ISO	RGD:1323057	6480464	Valproic Acid results in increased expression of STEAP1 mRNA	CTD	PMID:19101580\|PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:25192806\|PMID:26272509\|PMID:27188386\|PMID:28001369
Steap1	Rat	valproic acid	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Steap1	Rat	vancomycin	decreases expression	ISO	RGD:1323058	6480464	Vancomycin results in decreased expression of STEAP1 mRNA	CTD	PMID:18930951
Steap1	Rat	vorinostat	multiple interactions	ISO	RGD:1323057	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Steap1	Rat	vorinostat	increases expression	ISO	RGD:1323057	6480464	vorinostat results in increased expression of STEAP1 mRNA	CTD	PMID:26272509\|PMID:27188386
Steap1	Rat	zoledronic acid	increases expression	ISO	RGD:1323057	6480464	zoledronic acid results in increased expression of STEAP1 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steap1	Rat	copper ion import	NOT\|acts_upstream_of_or_within	ISO	RGD:1323058	1624291	PMID:16609065	RGD	PMID:16609065

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steap1	Rat	endosome	is_active_in	IBA	MGI:1915678\|MGI:1917608\|MGI:1921301\|MGI:1923560\|PANTHER:PTN008352243\|UniProtKB:Q658P3\|UniProtKB:Q8NFT2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Steap1	Rat	endosome	located_in	IEA	UniProtKB:Q9CWR7\|ensembl:ENSMUSP00000015796	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steap1	Rat	endosome	located_in	ISO	RGD:1323058	1624291	PMID:16609065	RGD	PMID:16609065
Steap1	Rat	endosome	located_in	IEA	UniProtKB-KW:KW-0967	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Steap1	Rat	endosome membrane	located_in	IEA	UniProtKB-SubCell:SL-0100	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Steap1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Steap1	Rat	plasma membrane	located_in	ISO	RGD:1323057	1624291	PMID:32409586	RGD	PMID:32409586
Steap1	Rat	plasma membrane	located_in	IEA	UniProtKB:Q9CWR7\|ensembl:ENSMUSP00000015796	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Steap1	Rat	plasma membrane	located_in	ISO	RGD:1323058	1624291	PMID:16609065	RGD	PMID:16609065
Steap1	Rat	plasma membrane	is_active_in	IBA	MGI:1915678\|MGI:1917608\|MGI:1921301\|MGI:1923560\|PANTHER:PTN001800605\|UniProtKB:Q687X5\|UniProtKB:Q8NFT2\|UniProtKB:Q9UHE8	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Steap1	Rat	cupric reductase (NADH) activity	NOT\|enables	ISO	RGD:1323058	1624291	PMID:16609065	RGD	PMID:16609065
Steap1	Rat	ferric-chelate reductase (NADPH) activity	NOT\|enables	ISO	RGD:1323057	1624291	PMID:32409586	RGD	PMID:32409586
Steap1	Rat	ferric-chelate reductase (NADPH) activity	NOT\|enables	ISO	RGD:1323058	1624291	PMID:16609065	RGD	PMID:16609065
Steap1	Rat	heme binding	enables	ISO	RGD:1323057	1624291	PMID:32409586	RGD	PMID:32409586
Steap1	Rat	oxidoreductase activity, acting on metal ions, NAD or NADP as acceptor	NOT\|enables	ISO	RGD:1323058	1624291	PMID:16609065	RGD	PMID:16609065
Steap1	Rat	protein binding	enables	ISO	RGD:1323057	1624291	UniProtKB:Q6NZ63 PMID:28514442, PMID:33961781	RGD	PMID:28514442\|PMID:33961781

Disease Annotations Click to see Annotation Detail View

pleomorphic xanthoastrocytoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(S)-nicotine (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-chloropropane-1,2-diol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

antimycin A (ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

cobalt dichloride (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dextran sulfate (ISO)

dicrotophos (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

furan (EXP)

genistein (ISO)

glycidol (EXP)

gold atom (ISO)

gold(0) (ISO)

Heptachlor epoxide (ISO)

L-methionine (ISO)

lead diacetate (EXP)

lipopolysaccharide (ISO)

manganese(II) chloride (EXP)

mercury dibromide (ISO)

methamphetamine (EXP)

methimazole (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

nickel atom (ISO)

nicotine (ISO)

oxaliplatin (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

potassium dichromate (ISO)

quercetin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulforaphane (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

copper ion import (ISO)

Cellular Component

endosome (IBA,IEA,ISO)

endosome membrane (IEA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

cupric reductase (NADH) activity (ISO)

ferric-chelate reductase (NADPH) activity (ISO)

heme binding (ISO)

oxidoreductase activity, acting on metal ions, NAD or NADP as acceptor (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16609065	PMID:19946888	PMID:23060075

Genomics

Comparative Map Data

Steap1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	29,231,809 - 29,242,317 (+)	NCBI		GRCr8
mRatBN7.2	4	28,276,972 - 28,287,484 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	28,276,909 - 28,287,479 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	33,259,056 - 33,269,580 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	29,185,120 - 29,195,644 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	27,571,914 - 27,582,416 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	25,435,885 - 25,446,393 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	25,435,873 - 25,446,461 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	25,343,985 - 25,354,493 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	24,962,598 - 24,973,106 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	24,966,530 - 24,973,107 (+)	NCBI
Celera	4	23,722,730 - 23,733,238 (+)	NCBI		Celera
Cytogenetic Map	4	q13	NCBI

STEAP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	90,154,469 - 90,164,827 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	90,154,456 - 90,164,829 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	89,783,783 - 89,794,141 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	89,621,625 - 89,632,077 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	89,428,339 - 89,438,791	NCBI
Celera	7	84,487,944 - 84,498,232 (+)	NCBI		Celera
Cytogenetic Map	7	q21.13	NCBI
HuRef	7	84,394,413 - 84,404,864 (+)	NCBI		HuRef
CHM1_1	7	89,713,500 - 89,723,952 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	91,404,904 - 91,415,261 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	89,114,457 - 89,124,907 (+)	NCBI

Steap1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	5,786,322 - 5,799,317 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	5,786,317 - 5,799,326 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	5,736,322 - 5,749,317 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	5,736,317 - 5,749,326 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	5,736,322 - 5,749,317 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	5,742,328 - 5,755,317 (-)	NCBI		MGSCv36	mm8
Celera	5	5,677,813 - 5,690,800 (-)	NCBI		Celera
Cytogenetic Map	5	A1	NCBI
cM Map	5	3.2	NCBI

Steap1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955432	7,410,315 - 7,415,995 (+)	NCBI	ChiLan1.0	ChiLan1.0

STEAP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	108,049,456 - 108,060,639 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	156,314,522 - 156,325,279 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	82,163,172 - 82,173,587 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	95,770,912 - 95,775,970 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	95,770,938 - 95,775,877 (+)	Ensembl	panpan1.1		panPan2

STEAP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	16,074,428 - 16,084,872 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	15,644,784 - 15,655,171 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	15,880,584 - 15,890,979 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	15,880,367 - 15,912,340 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	16,040,956 - 16,051,355 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	15,760,023 - 15,770,413 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	16,045,972 - 16,056,367 (+)	NCBI		UU_Cfam_GSD_1.0

Steap1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	29,516,144 - 29,526,508 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936621	3,842,155 - 3,852,676 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

STEAP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	70,091,211 - 70,295,690 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	8,996,943 - 8,997,498 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa11.1	9	70,276,031 - 70,295,693 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	76,846,191 - 76,865,850 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

STEAP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	58,773,037 - 58,783,659 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	58,773,006 - 58,783,351 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666042	45,441,801 - 45,452,222 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Steap1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624809	3,055,018 - 3,064,237 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Steap1
60 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	77
Count of miRNA genes:	64
Interacting mature miRNAs:	70
Transcripts:	ENSRNOT00000000018
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2302371	Stl22	Serum triglyceride level QTL 22	5.15		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	57114705	Rat
2303585	Bw86	Body weight QTL 86	4		body mass (VT:0001259)	body weight (CMO:0000012)	4	14678065	59678065	Rat
8552903	Pigfal2	Plasma insulin-like growth factor 1 level QTL 2	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	1	31934116	Rat
9590100	Sffal4	Serum free fatty acids level QTL 4	7.36	0.05	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	4	1	31934116	Rat
8552906	Pigfal3	Plasma insulin-like growth factor 1 level QTL 3			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	4	10084089	55084089	Rat
1357341	Gluco5	Glucose level QTL 5	6.4		adipocyte free fatty acid secretion trait (VT:0010465)	absolute change in adipocyte free fatty acid secretion per unit volume (CMO:0001446)	4	1	33250345	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
1357343	Gluco4	Glucose level QTL 4		0.00002	adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake to basal glucose uptake ratio (CMO:0000874)	4	1	33250345	Rat
6478766	Anxrr47	Anxiety related response QTL 47		0.09637	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	10084089	55084089	Rat
70222	Eae2	Experimental allergic encephalomyelitis QTL 2	4.3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	4	21333343	39505420	Rat
631642	Stl2	Serum triglyceride level QTL 2	3.3		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5219178	56647776	Rat
6478769	Anxrr48	Anxiety related response QTL 48		0.02514	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	10084089	55084089	Rat
631261	Tcas3	Tongue tumor susceptibility QTL 3	6.88		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	4	10814170	91360527	Rat
61333	Gluco16	Glucose level QTL 16	4.3	0.00001	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	1	30372989	Rat
634323	Hc2	Hypercalciuria QTL 2	2.15		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	4	210796	45210796	Rat
2313401	Anxrr27	Anxiety related response QTL 27			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	4	17933508	62933508	Rat
631209	Bw2	Body weight QTL2	4.2		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	4	9940885	44463908	Rat
8552803	Bw144	Body weight QTL 144	16		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	4	22710685	34430484	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	26907285	75585128	Rat
8694374	Bw155	Body weight QTL 155	3.39	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	4	10084089	55084089	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
9589046	Scfw2	Subcutaneous fat weight QTL 2	5.54	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	4	1	31934116	Rat
61412	Pia2	Pristane induced arthritis QTL 2	3.9		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	4	21333343	62278020	Rat
6478724	Anxrr35	Anxiety related response QTL 35		0.00449	defecation behavior trait (VT:0010462)	defecation measurement (CMO:0000997)	4	10084089	55084089	Rat
61415	Eae11	Experimental allergic encephalomyelitis QTL 11	2.9		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	4	1	39505420	Rat
1641905	Colcr1	Colorectal carcinoma resistance QTL 1	4.3	0.0003	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	4	1	29494328	Rat
619616	Bp79	Blood pressure QTL 79		0.0292	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	5214602	78882945	Rat
7387227	Uae40	Urinary albumin excretion QTL 40	2.9	0.0052	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	17946999	62946999	Rat
6909122	Insul22	Insulin level QTL 22	4.63		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	4	26907285	75585128	Rat
1358201	Gluco12	Glucose level QTL12	1.6		adipocyte glucose uptake trait (VT:0004185)	adipocyte maximal glucose uptake (CMO:0000870)	4	5218392	29593287	Rat
738021	Hcar13	Hepatocarcinoma resistance QTL 13	4.3		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	4	1	32584199	Rat
1358203	Stl19	Serum triglyceride level QTL 19	2.8	0.002	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	5218294	65958103	Rat
9590304	Scort17	Serum corticosterone level QTL 17	4.96	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	10084089	55084089	Rat
9589097	Slep11	Serum leptin concentration QTL 11	5.09	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	4	1	31934116	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1354665	Stl10	Serum triglyceride level QTL 10	3.57		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	4	21333343	44463908	Rat
1300141	Bp178	Blood pressure QTL 178			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	10024901	39524530	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	35	113	89	88	59	23	59	6	200	80	93	45	60	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000018 ⟹ ENSRNOP00000000018

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	28,276,909 - 28,287,479 (+)	Ensembl
Rnor_6.0 Ensembl	4	25,435,873 - 25,446,461 (+)	Ensembl

RefSeq Acc Id:

NM_001106629 ⟹ NP_001100099

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	29,231,809 - 29,242,317 (+)	NCBI
mRatBN7.2	4	28,276,972 - 28,287,484 (+)	NCBI
Rnor_6.0	4	25,435,885 - 25,446,393 (+)	NCBI
Rnor_5.0	4	25,343,985 - 25,354,493 (+)	NCBI
RGSC_v3.4	4	24,962,598 - 24,973,106 (+)	RGD
Celera	4	23,722,730 - 23,733,238 (+)	RGD

Sequence:

show sequence

CCGCGTGGGACTGGGAGTCCGGGCAGCGAGCCCCTCGCCGTCGGGTCCCACGAAGAAACTGGTG
GCTGAAGCCATATTCTGCAGCATTCATGGAGATCAGTAAAAATATTACGAACCCAGAAGAACTT
TGGAAAATGAAGCCTAAGGGGAACCTGGAAGATGACAGTTACTCGACTAAGGACACCGGAGAGA
CAAGCATGCTGAAAAGACCGGTGCTCTCGCCTTTGCCGCACACGGTCCACGTCGACGCCTTCGA
CTGCCCCACGGAGCTCCAGCACACGCAGGAACTCTTTCCAAACTGGCAATTGCCAATTAAAGTT
GCCGCCGTCCTATCGTCTCTCACCTTCCTGTACACTCTTCTGAGGGAAATCATTTACCCATTAG
TCGCTTCCCGCGAACAGTATTTTTATAAGATCCCGATCCTGGTCGTTAACAAAGTCTTGCCAAT
GGTCTCCATTACCCTCTTGGCATTGGTTTATCTGCCAGGAGAGATAGCGGCAGTTGTGCAGCTT
CGCAATGGGACCAAGTACAAGAAGTTCCCACCCTGGTTAGACAGATGGATGCTGGCGAGGAAAC
AATTTGGGCTCCTCAGCTTCTTCTTTGCAGTTCTGCACGCCATTTACAGTCTCTCGTACCCAAT
GAGACGGTCCTACAGATACAAGCTGCTCAACTGGGCTTACAAACAGGTTCAACAAAGCAAAGAA
GATGCCTGGGTTGAGCATGATGTCTGGAGAATGGAGATTTATGTGTCCCTGGGGATTGTGGGAC
TGGCCATCTTGGCTCTCTTGGCTGTGACATCTATCCCATCTGTGAGCGACTCTTTAACCTGGAG
AGAATTTCACTATATTCAGAGCAAACTGGGAATTGTCTCTCTTCTTCTGGGCACGGTACACGCT
TCGATTTTTGCCTGGAATAAATGGGTAGATATCAGTCAGTTTGTCTGGTACATGCCTCCGACTT
TCATGATAGCTGTTTTCCTTCCAACTGTTGTTCTGATCTGTAAAATTGTACTTTGCCTGCCCTG
CCTGAGGAAGAAGATACTGAAGATTAGATGTGGTTGGGAAGATGTCCGCAAAGTTAACAGGACT
GAGATGGCCTGCAGGTTGTAGAACTACTGTTTGCACATAATTGCTTAATACCGATGTCTTATAA
ACATTTCAAACCTGTGTCTGTTAATAAAATGAATACTTCTGGATCATT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100099	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL84334	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000018
	ENSRNOP00000000018.4

RefSeq Acc Id:

NP_001100099 ⟸ NM_001106629

- UniProtKB:

D3ZEK7 (UniProtKB/TrEMBL), A6K252 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEISKNITNPEELWKMKPKGNLEDDSYSTKDTGETSMLKRPVLSPLPHTVHVDAFDCPTELQHT
QELFPNWQLPIKVAAVLSSLTFLYTLLREIIYPLVASREQYFYKIPILVVNKVLPMVSITLLAL
VYLPGEIAAVVQLRNGTKYKKFPPWLDRWMLARKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKL
LNWAYKQVQQSKEDAWVEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSK
LGIVSLLLGTVHASIFAWNKWVDISQFVWYMPPTFMIAVFLPTVVLICKIVLCLPCLRKKILKI
RCGWEDVRKVNRTEMACRL

hide sequence

Ensembl Acc Id:

ENSRNOP00000000018 ⟸ ENSRNOT00000000018

Protein Domains

Ferric oxidoreductase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZEK7-F1-model_v2	AlphaFold	D3ZEK7	1-339	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692835

Promoter ID:

EPDNEW_R3360

Type:

initiation region

Name:

Steap1_1

Description:

STEAP family member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	25,435,880 - 25,435,940	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311543	AgrOrtholog
BioCyc Gene	G2FUF-45800	BioCyc
Ensembl Genes	ENSRNOG00000000017	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000018	ENTREZGENE
	ENSRNOT00000000018.8	UniProtKB/TrEMBL
InterPro	Fe3_reduct_TM_N	UniProtKB/TrEMBL
	STEAP_metalloreductase	UniProtKB/TrEMBL
KEGG Report	rno:297738	UniProtKB/TrEMBL
NCBI Gene	297738	ENTREZGENE
PANTHER	DUDULIN-RELATED	UniProtKB/TrEMBL
	METALLOREDUCTASE STEAP1-RELATED	UniProtKB/TrEMBL
Pfam	Ferric_reduct	UniProtKB/TrEMBL
PhenoGen	Steap1	PhenoGen
RatGTEx	ENSRNOG00000000017	RatGTEx
UniProt	A6K252	ENTREZGENE, UniProtKB/TrEMBL
	D3ZEK7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-19	Steap1	STEAP family member 1	Steap1	six transmembrane epithelial antigen of the prostate 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Steap1	six transmembrane epithelial antigen of the prostate 1	Steap1_predicted	six transmembrane epithelial antigen of the prostate 1 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Steap1_predicted	six transmembrane epithelial antigen of the prostate 1 (predicted)	Steap_predicted	six transmembrane epithelial antigen of the prostate (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-12	Steap_predicted	six transmembrane epithelial antigen of the prostate (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar