Kpna4 (karyopherin subunit alpha 4)

Advanced Search (OLGA)

Gene: Kpna4 (karyopherin subunit alpha 4) Rattus norvegicus

Analyze

Symbol:

Kpna4

Name:

karyopherin subunit alpha 4

RGD ID:

1311483

Description:

Predicted to enable nuclear import signal receptor activity and nuclear localization sequence binding activity. Predicted to be involved in NLS-bearing protein import into nucleus. Predicted to act upstream of with a positive effect on dopamine secretion and gene expression. Predicted to act upstream of or within protein import into nucleus and response to hydrogen peroxide. Predicted to be located in male germ cell nucleus and nuclear membrane. Predicted to be part of NLS-dependent protein nuclear import complex and nuclear pore. Predicted to be active in nucleoplasm. Orthologous to human KPNA4 (karyopherin subunit alpha 4); INTERACTS WITH 3,4-methylenedioxymethamphetamine; bisphenol A; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

importin; importin subunit alpha-3; importin subunit alpha-4; karyopherin (importin) alpha 4; karyopherin alpha 4; karyopherin alpha 4 (importin alpha 3); LOC361959; predicted role in nuclear import

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KPNA4 (karyopherin subunit alpha 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Kpna4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kpna4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KPNA4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KPNA4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kpna4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KPNA4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KPNA4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kpna4 (karyopherin subunit alpha 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PGLS (6-phosphogluconolactonase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	KPNA4 (karyopherin subunit alpha 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Kpna4 (karyopherin subunit alpha 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kpna4 (karyopherin alpha 4 (importin alpha 3))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ima-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Kap-alpha3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	kpna4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	155,635,679 - 155,691,056 (-)	NCBI		GRCr8
mRatBN7.2	2	153,319,380 - 153,381,085 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	153,324,273 - 153,381,081 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	160,455,225 - 160,510,312 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	158,505,743 - 158,560,831 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	153,138,510 - 153,193,599 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	165,684,345 - 165,739,874 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	165,684,345 - 165,739,874 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	185,045,503 - 185,101,032 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	159,073,108 - 159,128,180 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	159,023,070 - 159,078,143 (-)	NCBI
Celera	2	147,676,718 - 147,731,549 (-)	NCBI		Celera
Cytogenetic Map	2	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (EXP)

4-hydroxyphenyl retinamide (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

atrazine (ISO)

benzatropine (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

berberine (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

clozapine (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

cyproterone acetate (EXP)

decabromodiphenyl ether (ISO)

Dibutyl phosphate (ISO)

dimethylarsinous acid (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

graphite (EXP)

haloperidol (ISO)

hypochlorous acid (ISO)

iron dichloride (ISO)

ivermectin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

mercury dichloride (EXP)

methamphetamine (EXP)

methidathion (ISO)

microcystin RR (ISO)

microcystin-LR (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodimethylamine (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

ozone (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

perfluorononanoic acid (ISO)

phenobarbital (ISO)

phenol (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

dopamine secretion (ISO)

gene expression (ISO)

NLS-bearing protein import into nucleus (IBA,ISO)

protein import into nucleus (ISO)

response to hydrogen peroxide (ISO)

Cellular Component

male germ cell nucleus (ISO)

NLS-dependent protein nuclear import complex (ISO)

nuclear membrane (IEA,ISO)

nuclear pore (ISO)

nucleoplasm (IBA,ISO)

nucleus (IBA)

Molecular Function

nuclear import signal receptor activity (IBA,ISO)

nuclear localization sequence binding (IBA,ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:15689618	PMID:16906019	PMID:17682055	PMID:23376485	PMID:23773962

Genomics

Comparative Map Data

Kpna4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	155,635,679 - 155,691,056 (-)	NCBI		GRCr8
mRatBN7.2	2	153,319,380 - 153,381,085 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	153,324,273 - 153,381,081 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	160,455,225 - 160,510,312 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	158,505,743 - 158,560,831 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	153,138,510 - 153,193,599 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	165,684,345 - 165,739,874 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	165,684,345 - 165,739,874 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	185,045,503 - 185,101,032 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	159,073,108 - 159,128,180 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	159,023,070 - 159,078,143 (-)	NCBI
Celera	2	147,676,718 - 147,731,549 (-)	NCBI		Celera
Cytogenetic Map	2	q32	NCBI

KPNA4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	160,495,007 - 160,565,571 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	160,495,007 - 160,565,571 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	160,212,795 - 160,283,359 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	161,700,656 - 161,766,070 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	161,700,663 - 161,766,078	NCBI
Celera	3	158,639,975 - 158,705,390 (-)	NCBI		Celera
Cytogenetic Map	3	q25.33	NCBI
HuRef	3	157,611,349 - 157,681,994 (-)	NCBI		HuRef
CHM1_1	3	160,175,691 - 160,246,276 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	163,269,616 - 163,340,186 (-)	NCBI		T2T-CHM13v2.0

Kpna4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	68,979,554 - 69,034,425 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	68,974,482 - 69,034,446 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	69,072,221 - 69,127,092 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	69,067,149 - 69,127,113 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	68,876,143 - 68,931,014 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	69,160,150 - 69,215,021 (-)	NCBI		MGSCv36	mm8
Celera	3	69,178,407 - 69,233,653 (-)	NCBI		Celera
Cytogenetic Map	3	E1	NCBI
cM Map	3	32.18	NCBI

Kpna4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	11,025,095 - 11,093,429 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955448	11,025,095 - 11,094,053 (-)	NCBI	ChiLan1.0	ChiLan1.0

KPNA4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	158,436,633 - 158,501,115 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	158,440,441 - 158,506,068 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	157,521,009 - 157,586,790 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	165,565,059 - 165,635,014 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	165,572,140 - 165,635,135 (-)	Ensembl	panpan1.1		panPan2

KPNA4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	26,549,071 - 26,614,537 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	26,555,507 - 26,614,542 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	30,591,206 - 30,656,539 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	26,605,763 - 26,671,157 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	26,606,513 - 26,671,281 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	26,535,571 - 26,600,913 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	26,495,988 - 26,561,625 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	26,735,945 - 26,801,570 (-)	NCBI		UU_Cfam_GSD_1.0

Kpna4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	92,418,725 - 92,482,955 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936708	456,365 - 520,743 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936708	456,365 - 520,717 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KPNA4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	100,185,092 - 100,253,070 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	100,185,081 - 100,253,077 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KPNA4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	30,272,635 - 30,342,593 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	30,301,078 - 30,335,525 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	2,791,102 - 2,862,415 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kpna4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	38,277,386 - 38,341,611 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	38,277,328 - 38,341,440 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Kpna4
180 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	234
Count of miRNA genes:	153
Interacting mature miRNAs:	191
Transcripts:	ENSRNOT00000014384
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
6907363	Bp357	Blood pressure QTL 357	4.1	0.002	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	129540907	174540907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	118111229	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	118189491	163189491	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
631520	Bp73	Blood pressure QTL 73		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147686913	168355276	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	114654253	159654253	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat

Markers in Region

HSC0TF112

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	86,663,989 - 86,664,140 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	153,324,291 - 153,324,442 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	165,682,932 - 165,683,082	NCBI	Rnor6.0
Rnor_6.0	1	89,867,872 - 89,868,022	NCBI	Rnor6.0
Rnor_5.0	2	185,044,090 - 185,044,240	UniSTS	Rnor5.0
Rnor_5.0	1	91,018,934 - 91,019,084	UniSTS	Rnor5.0
RGSC_v3.4	1	86,488,832 - 86,488,982	UniSTS	RGSC3.4
RGSC_v3.4	2	159,071,695 - 159,071,845	UniSTS	RGSC3.4
Celera	2	147,675,071 - 147,675,221	UniSTS
Celera	1	81,030,759 - 81,030,909	UniSTS
Cytogenetic Map	2	q31	UniSTS

AA924555

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	153,324,319 - 153,324,503 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	86,664,017 - 86,664,201 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	89,867,900 - 89,868,083	NCBI	Rnor6.0
Rnor_6.0	2	165,682,960 - 165,683,143	NCBI	Rnor6.0
Rnor_5.0	2	185,044,118 - 185,044,301	UniSTS	Rnor5.0
Rnor_5.0	1	91,018,962 - 91,019,145	UniSTS	Rnor5.0
RGSC_v3.4	1	86,488,860 - 86,489,043	UniSTS	RGSC3.4
RGSC_v3.4	2	159,071,723 - 159,071,906	UniSTS	RGSC3.4
Celera	2	147,675,099 - 147,675,282	UniSTS
Celera	1	81,030,787 - 81,030,970	UniSTS
RH 3.4 Map	2	847.4	UniSTS
Cytogenetic Map	2	q31	UniSTS

GDB:451532

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	153,325,710 - 153,325,814 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	165,684,351 - 165,684,454	NCBI	Rnor6.0
Rnor_5.0	2	185,045,509 - 185,045,612	UniSTS	Rnor5.0
RGSC_v3.4	2	159,073,114 - 159,073,217	UniSTS	RGSC3.4
RGSC_v3.4	1	86,490,535 - 86,490,638	UniSTS	RGSC3.4
Celera	2	147,676,724 - 147,676,827	UniSTS
Celera	1	81,032,159 - 81,032,262	UniSTS
Cytogenetic Map	2	q31	UniSTS
Cytogenetic Map	1	q21	UniSTS

Kpna4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	153,324,403 - 153,325,314 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	165,683,044 - 165,683,954	NCBI	Rnor6.0
Rnor_5.0	2	185,044,202 - 185,045,112	UniSTS	Rnor5.0
RGSC_v3.4	2	159,071,807 - 159,072,717	UniSTS	RGSC3.4
Celera	2	147,675,183 - 147,676,093	UniSTS
Celera	1	81,030,871 - 81,031,763	UniSTS
Cytogenetic Map	2	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014793	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY779028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224515	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014384 ⟹ ENSRNOP00000014384

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	153,324,273 - 153,381,081 (-)	Ensembl
Rnor_6.0 Ensembl	2	165,684,345 - 165,739,874 (-)	Ensembl

RefSeq Acc Id:

NM_001014793 ⟹ NP_001014793

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	155,635,679 - 155,690,751 (-)	NCBI
mRatBN7.2	2	153,325,705 - 153,380,779 (-)	NCBI
Rnor_6.0	2	165,684,345 - 165,739,874 (-)	NCBI
Rnor_5.0	2	185,045,503 - 185,101,032 (-)	NCBI
RGSC_v3.4	2	159,073,108 - 159,128,180 (-)	RGD
Celera	2	147,676,718 - 147,731,549 (-)	RGD

Sequence:

show sequence

GCCATGGCGGACAACGAGAAATTGGACAACCAACGGCTCAAGAATTTTAAGAACAAAGGCCGCG
ACTTGGAGACTATGAGAAGACAACGAAATGAAGTTGTAGTTGAATTAAGAAAGAATAAAAGAGA
TGAACATCTCTTAAAGAGAAGGAATGTACCACAAGAAGATATCTGTGAAGACTCTGATATAGAC
GGTGATTATAGAGTGCAAAATACCTCTCTAGAAGCTATTGTTCAAAATGCTTCAAGTGATAACC
AAGGAATTCAATTAAGTGCAGTTCAAGCTGCTAGGAAGCTTTTATCCAGTGATCGAAATCCACC
AATTGATGACTTAATAAAATCTGGAATATTGCCTATTTTAGTTCATTGTCTTGAAAGAGATGAC
AATCCTTCTTTACAGTTTGAAGCTGCATGGGCTTTGACAAACATTGCATCTGGAACGTCTGAAC
AGACGCAAGCAGTGGTTCAGTCCAATGCTGTCCCACTTTTCCTGAGGCTTCTGCATTCACCCCA
TCAGAATGTCTGTGAACAGGCAGTGTGGGCATTGGGAAATATTATAGGTGATGGACCTCAGTGT
AGAGATTATGTGATAAGCCTTGGAGTTGTAAAACCTCTGCTTTCATTCATAAGTCCATCTATTC
CTATAACATTCTTAAGAAATGTTACCTGGGTCATGGTCAACTTATGTCGCCACAAGGACCCACC
ACCACCAATGGAGACAATTCAGGAGATTCTTCCAGCTCTTTGTGTATTAATTCATCACACAGAT
GTAAATATACTGGTAGATACTGTCTGGGCCCTATCTTACCTTACGGATGCTGGCAATGAGCAGA
TACAGATGGTAATAGACTCTGGAATAGTTCCTCATTTGGTTCCGCTACTCAGCCACCAGGAAGT
TAAAGTTCAGACTGCTGCACTGCGAGCTGTGGGCAACATTGTCACTGGAACTGATGAGCAAACA
CAAGTAGTTTTAAACTGTGATGCTCTCTCACACTTCCCAGCACTCCTCACTCATCCCAAAGAGA
AAATTAATAAGGAAGCAGTGTGGTTCCTCTCCAACATCACCGCAGGAAATCAACAGCAGGTTCA
GGCAGTAATTGATGCCAATCTTGTACCAATGATAATACACCTTTTGGATAAGGGAGATTTTGGC
ACTCAGAAAGAAGCTGCTTGGGCCATAAGTAACTTAACAATTAGTGGGAGGAAAGACCAAGTCG
CCTATCTCATCCAACAAAATGTTATTCCACCTTTTTGCAATTTGCTGACTGTAAAAGATGCACA
AGTCGTGCAAGTAGTGCTTGATGGACTAAGTAATATATTAAAAATGGCTGAAGATCAAGCGGAA
ACCATAGCCAATCTCATAGAAGAATGTGGTGGACTGGAGAAAATTGAACAACTTCAGAATCATG
AAAATGAGGACATCTACAAATTGGCCTATGAGATCATTGACCAGTTCTTCTCTTCAGATGATAT
TGATGAAGATCCTAGCCTTGTTCCAGAGTCAGTTCAAGGTGGAACATTTGGTTTCAATTCATCT
ACCAATGTACCAACAGAGGGGTTCCAGTTTTAGAGAGATGTTGTGGAAGTTAGGTACAATGCAG
CACCGAGAAATATATATATATATACACATATATATAAAAAGGTTTGATCCATCAAGCTTGGCTC
ATGGGATCTGCTGCTGCATTAAATCGGGAGAGAAAATGTGAAGATTTCATTTGGAATCACAGAA
AATGCCCAAATGAGTCAAGGTGGCGAGTGGGTGCGAGTGAGAATGAGTGGCAATGTAAGGAAAG
CGTGACACAAATGCTTATTTAGGTTGAGAGTAAAGGGCTACAGGTCACTTCGGTGCCTGAGACG
GAGCATTGACTTACTCTATCAATTGAGAAGTGAAATGCCATCATCATCAAGCCTTGTAAGCATA
AAAGCGATGCCCATATAAGTCAAGGAAAATGAGCCCAGGCCTCGCTGTGAAGCAGTGTATGAAT
GAACAGTGTTGAATGAATGTCTGGCTCCGTGG

hide sequence

RefSeq Acc Id:

XM_039102632 ⟹ XP_038958560

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	155,639,938 - 155,691,056 (-)	NCBI
mRatBN7.2	2	153,329,701 - 153,381,085 (-)	NCBI

RefSeq Acc Id:

XR_010063626

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	155,638,548 - 155,691,056 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001014793	(Get FASTA)	NCBI Sequence Viewer
	XP_038958560	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAX07455	(Get FASTA)	NCBI Sequence Viewer
	EDM00909	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014384.5

RefSeq Acc Id:

NP_001014793 ⟸ NM_001014793

- UniProtKB:

Q56R17 (UniProtKB/TrEMBL), F7FQB8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPQEDICEDSDIDG
DYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDN
PSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCR
DYVISLGVVKPLLSFISPSIPITFLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDV
NILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQ
VVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGT
QKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAET
IANLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGGTFGFNSST
NVPTEGFQF

hide sequence

Ensembl Acc Id:

ENSRNOP00000014384 ⟸ ENSRNOT00000014384

RefSeq Acc Id:	XP_038958560 ⟸ XM_039102632
- Peptide Label:	isoform X1

Protein Domains

IBB

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q56R17-F1-model_v2	AlphaFold	Q56R17	1-521	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311483	AgrOrtholog
BioCyc Gene	G2FUF-52835	BioCyc
Ensembl Genes	ENSRNOG00000010768	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000014384.7	UniProtKB/TrEMBL
Gene3D-CATH	1.20.5.690	UniProtKB/TrEMBL
	1.25.10.10	UniProtKB/TrEMBL
InterPro	ARM-like	UniProtKB/TrEMBL
	ARM-type_fold	UniProtKB/TrEMBL
	Arm_3	UniProtKB/TrEMBL
	Armadillo	UniProtKB/TrEMBL
	Importin-a-like_IBB-bd_dom	UniProtKB/TrEMBL
	Importin-a_IBB_sf	UniProtKB/TrEMBL
	Importing_su_alpha	UniProtKB/TrEMBL
KEGG Report	rno:361959	UniProtKB/TrEMBL
NCBI Gene	361959	ENTREZGENE
PANTHER	IMPORTIN ALPHA	UniProtKB/TrEMBL
	IMPORTIN SUBUNIT ALPHA-3	UniProtKB/TrEMBL
Pfam	Arm	UniProtKB/TrEMBL
	Arm_3	UniProtKB/TrEMBL
	IBB	UniProtKB/TrEMBL
PhenoGen	Kpna4	PhenoGen
PIRSF	Importin_alpha	UniProtKB/TrEMBL
PROSITE	ARM_REPEAT	UniProtKB/TrEMBL
	IBB	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010768	RatGTEx
SMART	ARM	UniProtKB/TrEMBL
Superfamily-SCOP	ARM-type_fold	UniProtKB/TrEMBL
UniProt	F7FQB8	ENTREZGENE, UniProtKB/TrEMBL
	Q56R17	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Kpna4	karyopherin subunit alpha 4	Kpna4	karyopherin alpha 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-27	Kpna4	karyopherin alpha 4	Kpna4	karyopherin alpha 4 (importin alpha 3)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Kpna4	karyopherin alpha 4 (importin alpha 3)	Kpna4	karyopherin (importin) alpha 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Kpna4	karyopherin (importin) alpha 4	Kpna4_predicted	karyopherin (importin) alpha 4 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Kpna4_predicted	karyopherin (importin) alpha 4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message