Prrx2 (paired related homeobox 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Prrx2 (paired related homeobox 2) Rattus norvegicus

Analyze

Symbol:

Prrx2

Name:

paired related homeobox 2

RGD ID:

1311471

Description:

Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; HMG box domain binding activity; and RNA polymerase II general transcription initiation factor activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including embryonic morphogenesis; positive regulation of cell population proliferation; and positive regulation of smoothened signaling pathway. Predicted to be active in nucleus. Orthologous to human PRRX2 (paired related homeobox 2); INTERACTS WITH 17alpha-ethynylestradiol; 3,3',4,4',5-pentachlorobiphenyl; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

paired mesoderm homeobox protein 2; Prx2

RGD Orthologs

Human

Mouse

Bonobo

Dog

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRRX2 (paired related homeobox 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Prrx2 (paired related homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRRX2 (paired related homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRRX2 (paired related homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRRX2 (paired related homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRRX2 (paired related homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prrx2 (paired related homeobox 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PRRX2 (paired related homeobox 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prrx2 (paired related homeobox 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9876	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	prrx2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	14,132,511 - 14,168,535 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	14,094,004 - 14,168,535 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	17,204,856 - 17,240,853 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	25,789,846 - 25,825,841 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	24,037,214 - 24,073,226 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	9,681,871 - 9,718,051 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	9,681,871 - 9,718,051 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	15,040,931 - 15,077,369 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	9,899,066 - 9,936,837 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	9,794,587 - 9,832,199 (+)	NCBI
Celera	3	8,892,836 - 8,928,706 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

primary coenzyme Q10 deficiency 7 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

acetaldehyde (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amosite asbestos (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

carbon nanotube (ISO)

carmustine (ISO)

chlordecone (ISO)

choline (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (ISO)

estriol (ISO)

flusilazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

indometacin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methapyrilene (ISO)

naphthalene (ISO)

nitrofen (EXP)

pentanal (ISO)

potassium dichromate (ISO)

propanal (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sulforaphane (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

artery morphogenesis (ISO)

cartilage development (ISO)

embryonic cranial skeleton morphogenesis (ISO)

embryonic limb morphogenesis (ISO)

embryonic skeletal system morphogenesis (ISO)

inner ear morphogenesis (ISO)

mesenchymal cell proliferation (ISO)

middle ear morphogenesis (ISO)

positive regulation of mesenchymal cell proliferation (ISO)

positive regulation of smoothened signaling pathway (ISO)

positive regulation of stem cell proliferation (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

smoothened signaling pathway (ISO)

stem cell proliferation (ISO)

transcription by RNA polymerase II (IEA)

Cellular Component

nucleus (IBA)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

HMG box domain binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

RNA polymerase II general transcription initiation factor activity (ISO)

RNA polymerase II transcription regulatory region sequence-specific DNA binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9729491	PMID:9876178	PMID:9882503	PMID:10664157	PMID:11532916	PMID:12713735	PMID:16582099	PMID:22577874	PMID:23644741	PMID:24881871	PMID:25795141

Genomics

Comparative Map Data

Prrx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	14,132,511 - 14,168,535 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	14,094,004 - 14,168,535 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	17,204,856 - 17,240,853 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	25,789,846 - 25,825,841 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	24,037,214 - 24,073,226 (+)	NCBI	Rnor_WKY
Rnor_6.0	3	9,681,871 - 9,718,051 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	9,681,871 - 9,718,051 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	15,040,931 - 15,077,369 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	9,899,066 - 9,936,837 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	9,794,587 - 9,832,199 (+)	NCBI
Celera	3	8,892,836 - 8,928,706 (+)	NCBI		Celera
Cytogenetic Map	3	p12	NCBI

PRRX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	129,665,647 - 129,722,674 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	129,665,647 - 129,722,674 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	132,427,926 - 132,484,953 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	131,467,741 - 131,524,774 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	129,507,473 - 129,564,503	NCBI
Celera	9	103,078,740 - 103,135,771 (+)	NCBI		Celera
Cytogenetic Map	9	q34.11	NCBI
HuRef	9	102,027,059 - 102,084,049 (+)	NCBI		HuRef
CHM1_1	9	132,576,580 - 132,633,630 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	141,870,240 - 141,927,272 (+)	NCBI		T2T-CHM13v2.0

Prrx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	30,735,076 - 30,771,263 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	30,724,984 - 30,771,263 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	30,845,064 - 30,881,251 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	30,834,972 - 30,881,251 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	30,700,887 - 30,736,767 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	30,667,290 - 30,703,262 (+)	NCBI		MGSCv36	mm8
Celera	2	30,550,237 - 30,586,613 (+)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	21.74	NCBI

PRRX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	9,629,135 - 9,686,753 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	100,792,324 - 100,849,923 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	129,478,374 - 129,506,866 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

PRRX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	54,089,046 - 54,112,595 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	54,093,163 - 54,096,348 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	53,285,306 - 53,346,966 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	54,984,314 - 55,035,503 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	54,988,556 - 55,035,116 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	53,767,114 - 53,825,066 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	54,083,947 - 54,145,111 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	54,176,396 - 54,229,502 (-)	NCBI		UU_Cfam_GSD_1.0

PRRX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	269,853,200 - 269,903,469 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	269,853,134 - 269,902,808 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	303,710,625 - 303,770,644 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRRX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	8,424,415 - 8,447,959 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	8,424,737 - 8,480,393 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666079	6,958,220 - 7,015,963 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prrx2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	5,656,521 - 5,692,934 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	5,656,456 - 5,684,383 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Prrx2
233 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	216
Count of miRNA genes:	153
Interacting mature miRNAs:	163
Transcripts:	ENSRNOT00000008270
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	diastolic blood pressure (CMO:0000005)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	3	10778704	50302886	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	0.0000000293	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat

Markers in Region

D3Rat231

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	14,158,705 - 14,158,916 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,708,213 - 9,708,423	NCBI	Rnor6.0
Rnor_5.0	3	15,067,140 - 15,067,350	UniSTS	Rnor5.0
RGSC_v3.4	3	9,925,540 - 9,925,751	RGD	RGSC3.4
RGSC_v3.4	3	9,925,541 - 9,925,751	UniSTS	RGSC3.4
RGSC_v3.1	3	9,820,908 - 9,821,119	RGD
Celera	3	8,918,780 - 8,918,990	UniSTS
SHRSP x BN Map	3	3.5699	RGD
SHRSP x BN Map	3	3.5699	UniSTS
Cytogenetic Map	3	p12	UniSTS

RH128429

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	14,168,188 - 14,168,404 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,717,705 - 9,717,920	NCBI	Rnor6.0
Rnor_5.0	3	15,077,023 - 15,077,238	UniSTS	Rnor5.0
RGSC_v3.4	3	9,936,491 - 9,936,706	UniSTS	RGSC3.4
Celera	3	8,928,360 - 8,928,575	UniSTS
RH 3.4 Map	3	48.5	UniSTS
Cytogenetic Map	3	p12	UniSTS

UniSTS:234365

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	14,168,292 - 14,168,416 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	9,717,809 - 9,717,932	NCBI	Rnor6.0
Rnor_5.0	3	15,077,127 - 15,077,250	UniSTS	Rnor5.0
RGSC_v3.4	3	9,936,595 - 9,936,718	UniSTS	RGSC3.4
Celera	3	8,928,464 - 8,928,587	UniSTS
Cytogenetic Map	3	p12	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		16	4	4		4			6	2	29
Low	1	25	11	2	11	2	6	9	58	22	8	11	6
Below cutoff	2	2	19	12	8	12	2	2	8	11	4		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001415156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC125306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000083251 ⟹ ENSRNOP00000070422

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	14,132,315 - 14,168,535 (+)	Ensembl
Rnor_6.0 Ensembl	3	9,681,871 - 9,718,051 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098429 ⟹ ENSRNOP00000096583

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	14,122,414 - 14,168,535 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000105946 ⟹ ENSRNOP00000095627

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	14,133,139 - 14,168,533 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000114142 ⟹ ENSRNOP00000085942

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	14,094,004 - 14,168,492 (+)	Ensembl

RefSeq Acc Id:

NM_001105739 ⟹ NP_001099209

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	14,132,511 - 14,168,535 (+)	NCBI
Rnor_6.0	3	9,681,871 - 9,718,051 (+)	NCBI
Rnor_5.0	3	15,040,931 - 15,077,369 (+)	NCBI
RGSC_v3.4	3	9,899,066 - 9,936,837 (+)	RGD
Celera	3	8,892,836 - 8,928,706 (+)	RGD

Sequence:

show sequence

CGCCCCGACAAGGGGCGTGTGGCCTGGGCCGCTGGCTAGCGAGCGGCCCGCCCGTTGGGGAGGG
CAGAAAGTTCGGGTCCCCGACCGACTGACTTGAGAGCCGGCGCGGCGAACAGCGGGAGGCGGCG
GCGGCCGGCAGAGGCGCGCCCGGGGCATGGACAGCGCGGCCGCCGCCTTCGCCTTGGACCCGCC
AGCGCCCGGCCCGGGGCCCCCGCCCGCACCCGGTGACTGCGCCCAGGCGCGCAAGAACTTCTCG
GTGAGCCACCTCCTGGACCTGGAGGAGGTGGCGGCTGCCGGGCGCAGGGCTGCGGGGCCGGTGC
CGGGGCCCGAGGCGCGGGAGGGAGCGGCGCGCGAACCGTCCGGGGGCAGCAGCGGCAGCGAGGC
GGCGCCGCAGGACGGTGAGTGCGCGGCCCCCGGCCATGGCAGTGCCACCAAACGGAAGAAGAAG
CAGCGTCGGAATCGAACCACATTCAACAGCAGCCAGCTGCAGGCGCTGGAGCGTGTATTTGAGC
GCACACACTACCCTGACGCCTTTGTGCGTGAAGAGCTAGCCCGCCGTGTCAACCTCAGTGAGGC
ACGTGTCCAAGTCTGGTTCCAGAACCGCCGTGCCAAGTTTCGCCGGAACGAACGTGCCATGCTG
GCTACCCGCTCTGCCTCGCTGCTCAAGTCTTACGGCCAGGAGGCAGCCATTGAGCAGCCTGTGG
CCCCCCGACCTACCACACTGAGCCCAGATTATCTATCCTGGCCAGCATCGTCCCCCTACAGCTC
GGTGCCTCCCTACAGCCCCGGAGGTTCAAGTCCTGCAACTCCTGGAGTCAATATGGCCAACAGC
ATCGCTAGCCTTCGCCTCAAGGCCAAAGAGTTCAGCTTACACCACAGCCAGGTGCCCACAGTGA
ACTGACAATGTGCACTGGGCCCAGCCTCCTTCCTGGCCCAATGGCAGACCGCAGTAAAGGAAGT
AGCCTTGTCCGTCCCTGTCCTCAGACAAACTGGGCAGCCTCTCCTGTGCCTTTTTCTCCATCGC
AGCTCTCTGAGTCCCAGAGGCCTGTTGGGTACTGGAAGCAACAGTTAAACAGGTCACTGCTATG
GTGGCTGAGATTGTGGCCTAAGGCCCCTGGGGTGGCCTGGCCAGAAGGCGGAGCTGGAGTCCGC
CAAGGAACTCACTTACTTATGTATTAAAACCAAAAAGCTTTTCTCTTTAAGGAATAAAAACATT
TTTCTTAAGCTCCA

hide sequence

RefSeq Acc Id:

XM_039104087 ⟹ XP_038960015

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	14,132,516 - 14,168,533 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099209	(Get FASTA)	NCBI Sequence Viewer
	NP_001402085	(Get FASTA)	NCBI Sequence Viewer
	XP_038960015	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL93289	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001099209 ⟸ NM_001105739

- Sequence:

show sequence

MDSAAAAFALDPPAPGPGPPPAPGDCAQARKNFSVSHLLDLEEVAAAGRRAAGPVPGPEAREGA
AREPSGGSSGSEAAPQDGECAAPGHGSATKRKKKQRRNRTTFNSSQLQALERVFERTHYPDAFV
REELARRVNLSEARVQVWFQNRRAKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTLSP
DYLSWPASSPYSSVPPYSPGGSSPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN

hide sequence

RefSeq Acc Id:

ENSRNOP00000070422 ⟸ ENSRNOT00000083251

RefSeq Acc Id:	XP_038960015 ⟸ XM_039104087
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000096583 ⟸ ENSRNOT00000098429

RefSeq Acc Id:

ENSRNOP00000095627 ⟸ ENSRNOT00000105946

RefSeq Acc Id:

ENSRNOP00000085942 ⟸ ENSRNOT00000114142

Protein Domains

Homeobox OAR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JXV9-F1-model_v2	AlphaFold	A0A0G2JXV9	1-247	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691967

Promoter ID:

EPDNEW_R2492

Type:

initiation region

Name:

Prrx2_1

Description:

paired related homeobox 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	9,681,934 - 9,681,994	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311471	AgrOrtholog
BioCyc Gene	G2FUF-50193	BioCyc
Ensembl Genes	ENSRNOG00000058329	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000070422	ENTREZGENE
	ENSRNOP00000070422.2	UniProtKB/TrEMBL
	ENSRNOP00000085942.1	UniProtKB/TrEMBL
	ENSRNOP00000095627.1	UniProtKB/TrEMBL
	ENSRNOP00000096583.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000083251	ENTREZGENE
	ENSRNOT00000083251.2	UniProtKB/TrEMBL
	ENSRNOT00000098429.1	UniProtKB/TrEMBL
	ENSRNOT00000105946.1	UniProtKB/TrEMBL
	ENSRNOT00000114142.1	UniProtKB/TrEMBL
Gene3D-CATH	Homeodomain-like	UniProtKB/TrEMBL
InterPro	Homeo_OAR	UniProtKB/TrEMBL
	Homeobox	UniProtKB/TrEMBL
	Homeobox_CS	UniProtKB/TrEMBL
	Homeodomain-like	UniProtKB/TrEMBL
	PRRX1/2	UniProtKB/TrEMBL
NCBI Gene	113931	ENTREZGENE
PANTHER	PAIRED MESODERM HOMEOBOX PROTEIN 2	UniProtKB/TrEMBL
	PTHR46385	UniProtKB/TrEMBL
Pfam	Homeobox	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
PhenoGen	Prrx2	PhenoGen
PROSITE	HOMEOBOX_1	UniProtKB/TrEMBL
	HOMEOBOX_2	UniProtKB/TrEMBL
	OAR	UniProtKB/TrEMBL
SMART	HOX	UniProtKB/TrEMBL
Superfamily-SCOP	Homeodomain_like	UniProtKB/TrEMBL
UniProt	A0A0G2JXV9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A4E1_RAT	UniProtKB/TrEMBL
	A0A8I6AK36_RAT	UniProtKB/TrEMBL
	A0A8I6ASS2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Prrx2	paired related homeobox 2	Prrx2_predicted	paired related homeobox 2 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Prrx2_predicted	paired related homeobox 2 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar