Wnt7b (Wnt family member 7B) - Rat Genome Database

Name: Wnt7b
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Wnt7b (Wnt family member 7B) Rattus norvegicus

Analyze

Symbol:

Wnt7b

Name:

Wnt family member 7B

RGD ID:

1311441

Description:

Predicted to enable chemoattractant activity involved in axon guidance; cytokine activity; and frizzled binding activity. Involved in several processes, including positive regulation of JNK cascade; regulation of cell projection size; and response to glucocorticoid. Located in extracellular space. Orthologous to human WNT7B (Wnt family member 7B); PARTICIPATES IN Wnt signaling, canonical pathway; Wnt signaling, the planar cell polarity pathway; Wnt signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC315196; protein Wnt-7b; wingless-related MMTV integration site 7B; wingless-type MMTV integration site family, member 7B

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WNT7B (Wnt family member 7B)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Wnt7b (wingless-type MMTV integration site family, member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wnt7b (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WNT7B (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WNT7B (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wnt7b (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WNT7B (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WNT7B (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wnt7b (Wnt family member 7B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	WNT7A (Wnt family member 7A)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	WNT7B (Wnt family member 7B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Wnt7b (wingless-type MMTV integration site family, member 7B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	wnt7bb (wingless-type MMTV integration site family, member 7Bb)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wnt7ba (wingless-type MMTV integration site family, member 7Ba)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	cwn-2	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Wnt2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wnt7b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	116,634,817 - 116,679,459 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	116,634,814 - 116,679,581 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	118,387,429 - 118,429,756 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	120,613,164 - 120,655,493 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	120,582,608 - 120,624,937 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	126,423,418 - 126,465,724 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	126,420,656 - 126,465,723 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	126,136,632 - 126,178,957 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	123,533,713 - 123,554,333 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	123,567,943 - 123,588,563 (-)	NCBI
Celera	7	112,932,206 - 112,952,808 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

breast cancer (ISO)

breast fibroadenoma (ISO)

Experimental Mammary Neoplasms (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Phelan-McDermid syndrome (ISO)

syndromic microphthalmia 5 (ISO)

syndromic microphthalmia 9 (ISO)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (EXP)

celastrol (ISO)

choline (ISO)

cisplatin (ISO)

clothianidin (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

D-glucose (ISO)

dextran sulfate (ISO)

diazinon (EXP)

diethylstilbestrol (ISO)

endosulfan (ISO)

ethylbenzene (ISO)

fipronil (ISO)

folic acid (ISO)

formaldehyde (ISO)

fucoxanthin (ISO)

glucose (ISO)

glycidol (EXP)

L-methionine (ISO)

Lasiocarpine (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

manganese(II) chloride (EXP)

methapyrilene (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-Nitrosopyrrolidine (ISO)

nicotine (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

ochratoxin A (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

propanal (ISO)

retinyl acetate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sotorasib (ISO)

temozolomide (ISO)

testosterone (ISO)

titanium dioxide (ISO)

toluene (ISO)

trametinib (ISO)

trichostatin A (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

uranium atom (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anatomical structure regression (ISO)

angiogenesis (ISO)

apoptotic process involved in blood vessel morphogenesis (ISO)

canonical Wnt signaling pathway (IBA,ISO)

cell fate commitment (IBA)

cell population proliferation (ISO)

cell proliferation in forebrain (ISO)

cellular response to retinoic acid (ISO)

central nervous system vasculogenesis (ISO)

chemoattraction of dopaminergic neuron axon (ISO)

chorio-allantoic fusion (ISO)

developmental growth involved in morphogenesis (ISO)

embryonic organ development (ISO)

embryonic placenta morphogenesis (ISO)

establishment or maintenance of polarity of embryonic epithelium (ISO)

fibroblast proliferation (ISO)

forebrain regionalization (ISO)

homeostatic process (ISO)

in utero embryonic development (ISO)

inner medullary collecting duct development (ISO)

intracellular oxygen homeostasis (ISO)

lobar bronchus development (ISO)

lung development (ISO)

lung epithelium development (ISO)

lung morphogenesis (ISO)

lung-associated mesenchyme development (ISO)

mammary gland epithelium development (ISO)

metanephric collecting duct development (ISO)

metanephric epithelium development (ISO)

metanephric loop of Henle development (ISO)

metanephros morphogenesis (ISO)

negative regulation of neurogenesis (ISO)

negative regulation of smoothened signaling pathway (ISO)

neuron differentiation (IBA,ISO)

neuron projection development (IMP)

neuron projection morphogenesis (IDA)

odontogenesis of dentin-containing tooth (ISO)

osteoblast differentiation (ISO)

outer medullary collecting duct development (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of gene expression (ISO)

positive regulation of JNK cascade (IBA,IDA,IMP)

positive regulation of osteoblast differentiation (ISO)

regulation of cell projection size (IDA)

renal inner medulla development (ISO)

renal outer medulla development (ISO)

response to glucocorticoid (IEP)

smooth muscle cell differentiation (ISO)

stem cell development (ISO)

stem cell proliferation (ISO)

synapse organization (ISO)

trachea cartilage morphogenesis (ISO)

vasculature development (ISO)

Wnt signaling pathway (ISO)

Wnt signaling pathway, planar cell polarity pathway (ISO)

Cellular Component

cell surface (ISO)

extracellular space (IBA,IDA)

Molecular Function

chemoattractant activity involved in axon guidance (ISO)

cytokine activity (IBA)

frizzled binding (IBA,ISO)

protein binding (ISO)

receptor ligand activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

basal cell carcinoma pathway (IEA)

Hedgehog signaling pathway (IEA)

Wnt signaling pathway (IEA,ISO)

Wnt signaling, canonical pathway (IGI,ISO)

Wnt signaling, the planar cell polarity pathway (IMP,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The p53 transcriptional target gene wnt7b contributes to NGF-inducible neurite outgrowth in neuronal PC12 cells.	Brynczka C and Merrick BA, Differentiation. 2008 Jan 2;.
2.	High expression of Wnt7b in human superficial bladder cancer vs invasive bladder cancer.	Bui TD, etal., Br J Cancer. 1998;77(2):319-24.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Differential expression of human Wnt genes 2, 3, 4, and 7B in human breast cell lines and normal and disease states of human breast tissue.	Huguet EL, etal., Cancer Res. 1994 May 15;54(10):2615-21.
6.	Pax6 is required for production and maintenance of progenitor cells in postnatal hippocampal neurogenesis.	Maekawa M, etal., Genes Cells. 2005 Oct;10(10):1001-14.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Expression of Wnt genes and frizzled 1 and 2 receptors in normal breast epithelium and infiltrating breast carcinoma.	Milovanovic T, etal., Int J Oncol. 2004 Nov;25(5):1337-42.
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	The Wnt Homepage	Roel Nusse - Howard Hughes Medical Institute and the Department of Developmental Biology at Stanford University, California, USA
14.	Wnt signaling through Dishevelled, Rac and JNK regulates dendritic development.	Rosso SB, etal., Nat Neurosci. 2005 Jan;8(1):34-42. Epub 2004 Dec 19.
15.	Transformation by Wnt family proteins correlates with regulation of beta-catenin.	Shimizu H, etal., Cell Growth Differ. 1997 Dec;8(12):1349-58.
16.	Alternative wnt signaling is initiated by distinct receptors.	van Amerongen R, etal., Sci Signal. 2008 Sep 2;1(35):re9.
17.	Zhonghua er ke za zhi. Chinese journal of pediatrics	Wang Q and Zhao DY, Zhonghua Er Ke Za Zhi. 2008 Apr;46(4):286-90.
18.	Wnt7b activates canonical signaling in epithelial and vascular smooth muscle cells through interactions with Fzd1, Fzd10, and LRP5.	Wang Z, etal., Mol Cell Biol. 2005 Jun;25(12):5022-30.
19.	Differential transformation of mammary epithelial cells by Wnt genes.	Wong GT, etal., Mol Cell Biol. 1994 Sep;14(9):6278-86.

Additional References at PubMed

PMID:8167409	PMID:10781055	PMID:11543617	PMID:12147135	PMID:12239632	PMID:12429992	PMID:12843296	PMID:15164427	PMID:15576404	PMID:16163358	PMID:16818724	PMID:17804636
PMID:18056042	PMID:18343501	PMID:18367557	PMID:19023080	PMID:19060336	PMID:19129494	PMID:19690384	PMID:19734317	PMID:21106844	PMID:26429533	PMID:28733458	PMID:31001900
PMID:36942896

Genomics

Comparative Map Data

Wnt7b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	7	116,634,817 - 116,679,459 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	116,634,814 - 116,679,581 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	118,387,429 - 118,429,756 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	120,613,164 - 120,655,493 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	120,582,608 - 120,624,937 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	126,423,418 - 126,465,724 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	126,420,656 - 126,465,723 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	126,136,632 - 126,178,957 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	123,533,713 - 123,554,333 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	123,567,943 - 123,588,563 (-)	NCBI
Celera	7	112,932,206 - 112,952,808 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

WNT7B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	45,920,366 - 45,977,162 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	45,920,366 - 45,977,162 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	46,316,246 - 46,373,042 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	44,696,316 - 44,751,395 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	44,638,195 - 44,666,564	NCBI
Cytogenetic Map	22	q13.31	NCBI
HuRef	22	29,261,652 - 29,291,436 (-)	NCBI		HuRef
CHM1_1	22	46,275,362 - 46,332,075 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	46,405,017 - 46,461,763 (-)	NCBI		T2T-CHM13v2.0

Wnt7b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	85,419,638 - 85,466,022 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	85,419,638 - 85,466,674 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	85,535,437 - 85,581,821 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	85,535,437 - 85,582,473 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	85,365,867 - 85,412,251 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	85,363,207 - 85,409,348 (-)	NCBI		MGSCv36	mm8
Celera	15	87,665,622 - 87,712,020 (-)	NCBI		Celera
Cytogenetic Map	15	E2	NCBI
cM Map	15	40.39	NCBI

Wnt7b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	30,144,869 - 30,181,791 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	30,146,185 - 30,185,693 (-)	NCBI	ChiLan1.0	ChiLan1.0

WNT7B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	22	58,449,387 - 58,504,009 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	22	44,988,647 - 45,039,601 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	44,988,647 - 45,044,841 (-)	Ensembl	panpan1.1		panPan2

WNT7B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	20,160,916 - 20,208,786 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	20,160,206 - 20,243,160 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	20,083,094 - 20,132,215 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	20,894,626 - 20,943,739 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	20,894,149 - 20,976,956 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	20,614,947 - 20,664,056 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	20,927,809 - 20,976,907 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	21,108,730 - 21,157,847 (+)	NCBI		UU_Cfam_GSD_1.0

Wnt7b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	3,869,498 - 3,909,805 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936629	3,869,523 - 3,909,808 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936629	3,869,976 - 3,907,932 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WNT7B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	3,521,288 - 3,572,314 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	3,521,412 - 3,572,322 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	654,961 - 707,041 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WNT7B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	28,387,324 - 28,444,019 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	28,385,422 - 28,441,350 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	96,912,041 - 96,943,508 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wnt7b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	3,818,025 - 3,857,027 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	3,818,073 - 3,856,602 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wnt7b
152 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	80
Interacting mature miRNAs:	84
Transcripts:	ENSRNOT00000021196
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
1582240	Sffal1	Serum free fatty acids level QTL 1	3.4	0.0021	blood free fatty acid amount (VT:0001553)	serum free fatty acids level (CMO:0000547)	7	116677010	124049952	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	116677189	127103496	Rat

Markers in Region

D7Rat60

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	116,651,888 - 116,652,094 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	126,438,538 - 126,438,743	NCBI	Rnor6.0
Rnor_5.0	7	126,151,750 - 126,151,955	UniSTS	Rnor5.0
RGSC_v3.4	7	123,548,833 - 123,549,038	UniSTS	RGSC3.4
RGSC_v3.4	7	123,548,832 - 123,549,038	RGD	RGSC3.4
RGSC_v3.1	7	123,583,062 - 123,583,268	RGD
FHH x ACI Map	7	54.48	UniSTS
FHH x ACI Map	7	54.48	RGD
Cytogenetic Map	7	q34	UniSTS

D7Rat97

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	116,677,010 - 116,677,189 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	126,463,649 - 126,463,827	NCBI	Rnor6.0
Rnor_5.0	7	126,176,882 - 126,177,060	UniSTS	Rnor5.0
RGSC_v3.4	7	123,574,502 - 123,574,680	UniSTS	RGSC3.4
RGSC_v3.4	7	123,574,473 - 123,574,930	RGD	RGSC3.4
RGSC_v3.1	7	123,608,732 - 123,608,910	RGD
Celera	7	112,972,542 - 112,972,733	UniSTS
RH 3.4 Map	7	908.3	RGD
RH 3.4 Map	7	908.3	UniSTS
RH 2.0 Map	7	688.9	RGD
SHRSP x BN Map	7	70.2799	RGD
FHH x ACI Map	7	54.48	RGD
Cytogenetic Map	7	q34	UniSTS

Wnt7b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	116,634,873 - 116,635,350 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	126,421,533 - 126,422,009	NCBI	Rnor6.0
Rnor_5.0	7	126,134,747 - 126,135,223	UniSTS	Rnor5.0
RGSC_v3.4	7	123,531,828 - 123,532,304	UniSTS	RGSC3.4
Celera	7	112,930,321 - 112,930,797	UniSTS
Cytogenetic Map	7	q34	UniSTS

Wnt7b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	116,636,793 - 116,637,178 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	126,423,453 - 126,423,837	NCBI	Rnor6.0
Rnor_5.0	7	126,136,667 - 126,137,051	UniSTS	Rnor5.0
RGSC_v3.4	7	123,533,748 - 123,534,132	UniSTS	RGSC3.4
Celera	7	112,932,241 - 112,932,625	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium								60	13
Low	2	2	2		2			14	22	32	11
Below cutoff	18	39	30	12	30	3	3			8		3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009695	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001412610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB197137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC112534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021196 ⟹ ENSRNOP00000021196

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	7	126,423,418 - 126,465,723 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000081032 ⟹ ENSRNOP00000072573

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	116,634,814 - 116,675,400 (-)	Ensembl
Rnor_6.0 Ensembl	7	126,420,656 - 126,461,658 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108799 ⟹ ENSRNOP00000093131

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	116,634,814 - 116,679,581 (-)	Ensembl

RefSeq Acc Id:

NM_001009695 ⟹ NP_001009695

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	116,634,817 - 116,679,459 (-)	NCBI
Rnor_6.0	7	126,423,418 - 126,465,724 (-)	NCBI
Rnor_5.0	7	126,136,632 - 126,178,957 (-)	NCBI
RGSC_v3.4	7	123,533,713 - 123,554,333 (-)	RGD
Celera	7	112,932,206 - 112,952,808 (-)	RGD

Sequence:

show sequence

ATGCACAGAAACTTTCGAAAGTGGATCTTTTACGTGTTTCTCTGCTTTGGCGTCCTCTACGTGA
AGCTCGGAGCATTGTCATCCGTGGTGGCCCTGGGAGCCAACATCATCTGCAACAAGATTCCTGG
CCTGGCCCCACGGCAGCGAGCCATCTGCCAGAGCCGACCCGATGCCATCATCGTGATCGGGGAG
GGGGCGCAGATGGGTATCGATGAATGCCAGCACCAGTTCCGATTCGGCCGCTGGAACTGCTCCG
CCCTGGGCGAGAAGACCGTCTTTGGGCAAGAGCTCCGAGTAGGGAGTCGAGAGGCTGCCTTCAC
ATACGCCATCACCGCAGCAGGAGTGGCACACGCTGTCACGGCAGCCTGCAGCCAGGGCAATCTG
AGCAACTGTGGCTGTGACCGCGAGAAGCAAGGCTACTACAACCAGGCAGAAGGCTGGAAGTGGG
GGGGTTGCTCAGCAGACGTCCGCTATGGCATTGACTTTTCCCGCCGCTTCGTGGATGCTCGTGA
GATCAAAAAGAATGCCAGGCGCCTCATGAACCTTCACAACAATGAGGCAGGCAGAAAGGTTCTG
GAGGACCGCATGAAACTGGAATGTAAGTGTCACGGAGTGTCGGGCTCATGTACTACCAAAACCT
GCTGGACCACCCTGCCCAAGTTCCGCGAGGTGGGCCACCTACTCAAGGAGAAGTACAACGCAGC
TGTGCAGGTGGAGGTGGTGCGAGCCAGCCGCCTGCGCCAGCCCACCTTCCTGCGCATCAAGCAG
CTGCGCAGCTATCAGAAGCCGATGGAGACGGACCTGGTGTACATCGAGAAGTCGCCCAACTACT
GCGAGGAGGACGCGGCCACGGGCAGCGTAGGCACGCAGGGCCGCCTTTGCAACCGCACCTCGCC
GGGTGCCGACGGCTGTGACACCATGTGCTGCGGCCGTGGCTACAACACGCACCAGTACACCAAG
GTGTGGCAGTGCAACTGCAAATTCCACTGGTGTTGCTTCGTCAAGTGCAACACGTGCAGCGAGC
GCACCGAGGTCTTCACCTGCAAGTGA

hide sequence

RefSeq Acc Id:

NM_001412610 ⟹ NP_001399539

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	116,634,817 - 116,675,335 (-)	NCBI

RefSeq Acc Id:

XM_039079298 ⟹ XP_038935226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	7	116,634,817 - 116,657,377 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001009695	(Get FASTA)	NCBI Sequence Viewer
	NP_001399539	(Get FASTA)	NCBI Sequence Viewer
	XP_038935226	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAD83363	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072573
	ENSRNOP00000072573.1
	ENSRNOP00000093131
	ENSRNOP00000093131.1

RefSeq Acc Id:	NP_001009695 ⟸ NM_001009695
- Peptide Label:	isoform 1
- UniProtKB:	Q5NSW6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MHRNFRKWIFYVFLCFGVLYVKLGALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGE GAQMGIDECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNL SNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVL EDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQ LRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTK VWQCNCKFHWCCFVKCNTCSERTEVFTCK hide sequence

RefSeq Acc Id:

ENSRNOP00000021196 ⟸ ENSRNOT00000021196

RefSeq Acc Id:

ENSRNOP00000072573 ⟸ ENSRNOT00000081032

RefSeq Acc Id:	XP_038935226 ⟸ XM_039079298
- Peptide Label:	isoform X2

RefSeq Acc Id:

ENSRNOP00000093131 ⟸ ENSRNOT00000108799

RefSeq Acc Id:	NP_001399539 ⟸ NM_001412610
- Peptide Label:	isoform 2
- UniProtKB:	A0A0G2K3B7 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K3B7-F1-model_v2	AlphaFold	A0A0G2K3B7	1-353	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311441	AgrOrtholog
BioCyc Gene	G2FUF-32544	BioCyc
Ensembl Genes	ENSRNOG00000015750	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000081032	ENTREZGENE
	ENSRNOT00000081032.2	UniProtKB/TrEMBL
	ENSRNOT00000108799	ENTREZGENE
	ENSRNOT00000108799.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2460.20	UniProtKB/TrEMBL
InterPro	Wnt7	UniProtKB/TrEMBL
	Wnt_C	UniProtKB/TrEMBL
	Wnt_grthfactor_CS	UniProtKB/TrEMBL
	Wnt_SF	UniProtKB/TrEMBL
KEGG Report	rno:315196	UniProtKB/TrEMBL
NCBI Gene	315196	ENTREZGENE
PANTHER	PROTEIN WNT-7B	UniProtKB/TrEMBL
	Wnt	UniProtKB/TrEMBL
Pfam	wnt	UniProtKB/TrEMBL
PhenoGen	Wnt7b	PhenoGen
PRINTS	WNT7PROTEIN	UniProtKB/TrEMBL
	WNTPROTEIN	UniProtKB/TrEMBL
PROSITE	WNT1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015750	RatGTEx
SMART	WNT1	UniProtKB/TrEMBL
UniProt	A0A0G2K3B7	ENTREZGENE, UniProtKB/TrEMBL
	Q5NSW6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-29	Wnt7b	Wnt family member 7B	Wnt7b	wingless-type MMTV integration site family, member 7B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-14	Wnt7b	wingless-type MMTV integration site family, member 7B	Wnt7b	wingless-related MMTV integration site 7B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Wnt7b	wingless-related MMTV integration site 7B	Wnt7b_predicted	wingless-related MMTV integration site 7B (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Wnt7b_predicted	wingless-related MMTV integration site 7B (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)