Slc17a5 (solute carrier family 17 member 5)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc17a5 (solute carrier family 17 member 5) Rattus norvegicus

Analyze

Symbol:

Slc17a5

Name:

solute carrier family 17 member 5

RGD ID:

1311388

Description:

Enables sialic acid transmembrane transporter activity. Involved in sialic acid transport. Located in lysosome. Human ortholog(s) of this gene implicated in sialuria. Orthologous to human SLC17A5 (solute carrier family 17 member 5); PARTICIPATES IN amino sugar metabolic pathway; french type sialuria pathway; sialic acid storage disease pathway; INTERACTS WITH (+)-schisandrin B; acetamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC363103; proton-coupled sialic acid transporter; sialin; solute carrier family 17 (acidic sugar transporter), member 5; solute carrier family 17 (anion/sugar transporter), member 5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC17A5 (solute carrier family 17 member 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Slc17a5 (solute carrier family 17 (anion/sugar transporter), member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc17a5 (solute carrier family 17 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC17A5 (solute carrier family 17 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC17A5 (solute carrier family 17 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101977071 (sialin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC17A5 (solute carrier family 17 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC17A5 (solute carrier family 17 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc17a5 (solute carrier family 17 member 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SLC17A5 (solute carrier family 17 member 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slc17a5 (solute carrier family 17 (anion/sugar transporter), member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc17a5 (solute carrier family 17 member 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DAL5	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Saccharomyces cerevisiae (baker's yeast):	SOA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Saccharomyces cerevisiae (baker's yeast):	THI73	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Drosophila melanogaster (fruit fly):	CG6978	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Drosophila melanogaster (fruit fly):	Picot	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	FEN2	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Saccharomyces cerevisiae (baker's yeast):	YCT1	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Caenorhabditis elegans (roundworm):	slc-17.1	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Drosophila melanogaster (fruit fly):	MFS9	Alliance	DIOPT (Hieranoid\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	slc-17.2	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	MFS10	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TNA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Saccharomyces cerevisiae (baker's yeast):	SEO1	Alliance	DIOPT (Ensembl Compara\|Hieranoid)
Saccharomyces cerevisiae (baker's yeast):	VHT1	Alliance	DIOPT (Ensembl Compara\|Hieranoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Annotation category: suggests misassembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	79,394,416 - 79,429,387 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	8	84,924,240 - 84,959,248 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	83,201,391 - 83,236,397 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	81,024,070 - 81,059,076 (-)	NCBI	Rnor_WKY
Rnor_6.0	8	85,891,245 - 85,926,466 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	85,891,257 - 85,926,450 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	85,440,739 - 85,475,700 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	83,516,448 - 83,551,409 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	83,536,016 - 83,570,972 (-)	NCBI
Celera	8	79,140,301 - 79,175,337 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

focal segmental glomerulosclerosis (ISO)

focal segmental glomerulosclerosis 1 (ISO)

Free Sialic Acid Storage Disease (ISO)

genetic disease (ISO)

Gitelman syndrome (ISO)

Infantile Sialic Storage Disease (ISO)

lysosomal storage disease (ISS)

melanoma (ISO)

sialuria (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-Iodothyronamine (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

atrazine (ISO)

avobenzone (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

caffeine (EXP,ISO)

calcitriol (ISO)

carbamazepine (ISO)

chlordecone (ISO)

cisplatin (ISO)

clofibrate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dieldrin (EXP)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

methapyrilene (EXP)

methoxyacetic acid (EXP)

methylmercury chloride (EXP,ISO)

mirex (EXP)

Monobutylphthalate (EXP)

oxycodone (EXP)

panobinostat (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

potassium chromate (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

Soman (EXP)

sunitinib (ISO)

T-2 toxin (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

vanadium atom (ISO)

vanadium(0) (ISO)

Yessotoxin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

response to bacterium (ISO)

sialic acid transport (IDA,ISO)

Cellular Component

cytoplasmic vesicle (ISO)

cytosol (ISO)

lysosomal membrane (ISO)

lysosome (IDA)

plasma membrane (ISO)

Molecular Function

D-glucuronate transmembrane transporter activity (ISO)

sialic acid transmembrane transporter activity (IDA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (ISO)

french type sialuria pathway (ISO)

sialic acid storage disease pathway (ISO)

Tay-Sachs disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	A new gene, encoding an anion transporter, is mutated in sialic acid storage diseases.	Verheijen FW, etal., Nat Genet. 1999 Dec;23(4):462-5.
10.	Varied mechanisms underlie the free sialic acid storage disorders.	Wreden CC, etal., J Biol Chem. 2005 Jan 14;280(2):1408-16. Epub 2004 Oct 29.

Additional References at PubMed

PMID:3961501	PMID:12477932	PMID:15006695	PMID:17897319	PMID:18695252	PMID:20424173	PMID:23012479	PMID:23221336

Genomics

Comparative Map Data

Slc17a5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	79,394,416 - 79,429,387 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	8	84,924,240 - 84,959,248 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	83,201,391 - 83,236,397 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	81,024,070 - 81,059,076 (-)	NCBI	Rnor_WKY
Rnor_6.0	8	85,891,245 - 85,926,466 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	85,891,257 - 85,926,450 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	85,440,739 - 85,475,700 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	83,516,448 - 83,551,409 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	83,536,016 - 83,570,972 (-)	NCBI
Celera	8	79,140,301 - 79,175,337 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

SLC17A5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	73,593,379 - 73,653,992 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	6	73,593,379 - 73,653,992 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	74,303,102 - 74,363,715 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	74,359,823 - 74,420,417 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	74,359,823 - 74,420,411	NCBI
Celera	6	74,698,011 - 74,758,950 (-)	NCBI		Celera
Cytogenetic Map	6	q13	ENTREZGENE
HuRef	6	71,502,886 - 71,563,295 (-)	NCBI		HuRef
CHM1_1	6	74,469,444 - 74,529,997 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	74,770,746 - 74,832,087 (-)	NCBI		T2T-CHM13v2.0

Slc17a5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	78,443,769 - 78,495,346 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	78,443,770 - 78,495,323 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	78,536,487 - 78,588,045 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	78,536,488 - 78,588,041 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	78,384,316 - 78,435,834 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	79,300,217 - 79,352,237 (-)	NCBI		MGSCv36	mm8
MGSCv36	9	78,322,193 - 78,373,711 (-)	NCBI		MGSCv36	mm8
Celera	9	75,715,413 - 75,754,082 (-)	NCBI		Celera
Cytogenetic Map	9	E1	NCBI

Slc17a5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955493	8,693,679 - 8,719,250 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955493	8,693,933 - 8,719,250 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC17A5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	6	74,702,438 - 74,760,557 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	74,702,447 - 74,760,557 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	6	71,404,354 - 71,477,511 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SLC17A5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	35,648,349 - 35,683,115 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	35,649,376 - 35,683,534 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	35,519,601 - 35,554,433 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	36,205,167 - 36,239,946 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	36,205,170 - 36,240,367 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	35,744,104 - 35,778,866 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	35,765,409 - 35,800,192 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	35,890,179 - 35,924,958 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101977071
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	70,926,024 - 70,941,358 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936859	668,900 - 684,207 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC17A5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	92,286,841 - 92,342,776 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	92,286,821 - 92,342,788 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	103,338,170 - 103,394,107 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC17A5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	1,499,110 - 1,558,954 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	1,499,651 - 1,558,951 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666058	7,403,356 - 7,463,091 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc17a5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624819	767,340 - 815,903 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624819	766,332 - 816,255 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc17a5
403 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	166
Count of miRNA genes:	129
Interacting mature miRNAs:	145
Transcripts:	ENSRNOT00000012474
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088624	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	75311777	84531599	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	75311938	82925521	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat

Markers in Region

D8Rat22

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	79,395,194 - 79,395,351 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	85,892,230 - 85,892,386	NCBI	Rnor6.0
Rnor_5.0	8	85,441,518 - 85,441,674	UniSTS	Rnor5.0
RGSC_v3.4	8	83,517,166 - 83,517,530	RGD	RGSC3.4
RGSC_v3.4	8	83,517,227 - 83,517,383	UniSTS	RGSC3.4
RGSC_v3.1	8	83,536,784 - 83,536,940	RGD
Celera	8	79,141,080 - 79,141,236	UniSTS
RH 3.4 Map	8	923.4	UniSTS
RH 3.4 Map	8	923.4	RGD
RH 2.0 Map	8	745.5	RGD
SHRSP x BN Map	8	46.0	RGD
Cytogenetic Map	8	q31	UniSTS

RH128569

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	79,394,375 - 79,394,594 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	85,891,411 - 85,891,629	NCBI	Rnor6.0
Rnor_5.0	8	85,440,699 - 85,440,917	UniSTS	Rnor5.0
RGSC_v3.4	8	83,516,408 - 83,516,626	UniSTS	RGSC3.4
Celera	8	79,140,261 - 79,140,479	UniSTS
RH 3.4 Map	8	924.2	UniSTS
Cytogenetic Map	8	q31	UniSTS

RH138504

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	79,395,580 - 79,395,704 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	85,892,616 - 85,892,739	NCBI	Rnor6.0
Rnor_5.0	8	85,441,904 - 85,442,027	UniSTS	Rnor5.0
RGSC_v3.4	8	83,517,613 - 83,517,736	UniSTS	RGSC3.4
Celera	8	79,141,466 - 79,141,589	UniSTS
RH 3.4 Map	8	924.99	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1		7	7		7			50	23	8	1
Low	2	43	50	34	19	34	8	11	24	12	33	10	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY800277	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097482	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000012474 ⟹ ENSRNOP00000012474

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	8	85,891,257 - 85,926,450 (-)	Ensembl

RefSeq Acc Id:

NM_001009713 ⟹ NP_001009713

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	79,394,416 - 79,429,387 (-)	NCBI
Rnor_6.0	8	85,891,451 - 85,926,412 (-)	NCBI
Rnor_5.0	8	85,440,739 - 85,475,700 (-)	NCBI
RGSC_v3.4	8	83,516,448 - 83,551,409 (-)	RGD
Celera	8	79,140,301 - 79,175,337 (-)	RGD

Sequence:

show sequence

CTGTCAGCCAAGCAACGATAGTGGCACATCTGCTCTCCAGGCGTCATGAGGCCCCTGCTTCGGG
GTCCGGCGGGAAACGATGATGAGGAAAGCTCGGACAGCACCCCGCTCCTGCCTAGCGCCCGGCA
GATCGAAGCGGCTCCAGCATGCTGCTCTGCTCGGTACAATTTAGCACTGTTGGCGTTCTGTGGT
TTCTTCGTTCTCTATGCTTTACGGGTGAACCTGAGTGTGGCGCTAGTGGACATGGTAGATTCCA
ACAGCACTCTGACTGATAACAGAACTTCCAAGGAGTGTGCGGAACACTCTGCCCCCGTAAAAGT
CCACCACAACCACACAGGTAAAAAGTACCAGTGGGATGCAGAAACTCAAGGGTGGATTCTCGGC
TCCTTTTTTTACGGCTACATCGTCACACAGATCCCCGGGGGGTACATGGCCAGCAGAATCGGAG
GGAAGCTGCTGCTGGGCCTGGGCATCTTAGGCACCGCCGTGTTCACCCTGTTCACACCCCTGGC
CGCTGACCTGGGAGTGGTGGCGCTTATCGTGCTGAGAGCACTGGAAGGACTCGGGGAGGGTGTC
ACGTTTCCGGCTATGCATGCCATGTGGTCCTCCTGGGCTCCCCCTCTGGAAAGAAGCAAGCTTC
TCACCATTTCTTATGCAGGAGCACAGCTTGGGACAGTAATCTCACTTCCTCTTTCCGGAATAAT
TTGCTACTATATGAATTGGACTTATGTCTTCTACCTTTTTGGTTTAGTTGGAATTGTCTGGTTT
ATTTTATGGATGTGGATAGTCAGTGATACACCAGAAACTCACAAGACAATCTCCCACTATGAAA
AGGAATACATTGTTTCATCATTAAAAAATCAGCTTTCTTCACAGAAGGTAGTGCCATGGGTATC
CATCTTGAAGTCACTGCCACTTTGGGCAATTGTAGTAGCACATTTTTCCTACAACTGGACCTTT
TACACTCTACTGACGTTGTTGCCTACATATATGAAAGAAATCCTAAGGTTCAATGTTCAAGAGA
ACGGGTTTTTATCTGCATTGCCCTATTTTGGCTGTTGGTTATGCATGATTGTCTGTGGTCAAGC
CGCTGATTATTTAAGAGTCAAGTGGAATTTTTCAACCATAAGCGTTCGGAGAATTTTTTCCCTC
ATAGGAATGGTTGGCCCTGCAGTTTTCCTAGTCGCGGCTGGATTTATAGGCTGTGACTATTCTT
TGGCTGTTGCATTCCTAACCATATCCACGACGCTGGGAGGCTTCGCCTCTTCTGGATTTAGCAT
CAACCATCTGGATATCGCCCCTTCGTATGCCGGCATCCTCCTGGGCATCACAAACACGTTTGCC
ACCATTCCCGGAATGATTGGGCCCATCATTGCTAAAAGTCTGACCCCTGATAACACTATTAAGG
AATGGCAGACTGTCTTCTGTATCGCTGCTGCTATTAACGTGTTCGGCGCCATTTTCTTCACACT
GTTTGCCAAAGGAGAGGTGCAGAACTGGGCTCTCAGTGACCACCACGGACACGGAAACTGAAGA
CGACAATAATTAATATATTTTTATTTATCATGGAAACTGAAAGTGCCTTTGATTGCATAATAAG
CATTCTATGTGAGGAAAAAATAGTACTTATATTTGTAAGGTAATCATGAAATGTTACTGGTTCC
AAGATCATTTAAAATGAGCTGGTTTTAATTATCACTAATATATCTGCCAGACCTTACACTTGGG
TTCACACACCAGGCTGCAAGTAAGGCAGCATAATAAAAAGGTAAGGGCGTAGGAAATGAAGCTG
AAGTGGAACACACACACACACACACACACACACACACACACACTTGTTTAATTAAATTAGATAA
ATCGTCTCAGCTCTTGCTAAATACCTGTTTTTGTCTACCTCCCTTATAAAAAATGGTTGCCAAC
TCTCCCTAACACATAGATCTCAATAACATCTCCGTAAAGCTGCCAGCCACAGTAAGAGTTGGCC
TGGTACCCGCACTGAAGGCCCCGTGCCCAGGCAGCTGCCAAGCACCCCCTCCCTGACCGCAGGG
CTGGAATGCCCAGCACTCATGGGGTGGCTTCCAAGTGCAGGGCCAGTGACAGCATTTGGCTGAC
ACTCTTCCCCCGTGGCTGTTAAAGTGTAGATAAAGCCCTAAGTGGACTGGAGCGGTGGGATCCC
CAGCTACTGTCTTGACACTGCCAGCCAGCCTTGGCAGCACCCAGGCCTGCTACTGGAAGGTGAT
CTACAAAGCAGAATCGTGATACCCAGTCAATCACAGAGAACATCCTCGATAAAATGACTGCTAT
GTGAGTCAGAATAAATGTTCACATGCAGGTTTTTCTGGCTACGTTAGAACTTATTTAAATGTCT
TTCCCTCAGTCTGTCTTGATTTATGCTTCTGGTCACAGTTTAAAGTGACTTTCAGGGCCAGGGG
TTTGGCTCAGTGGTAGAACACTTACATAGGACTGTGGTCTGTCCAACAGCAAAATGGAGGTAAA
TGACTGGGCACCCAAAGCTGGTAAATCATGCAGCTTCCTCTGACCAGAGTTTCCTGGTTGTTAG
GCATACTGTAAGAGGTCCCTGGTCTGTGTGGTGGCTCATGCCTTTAATCCCAGAACTTGGGAGG
CAGGGGCAACTTCAAGACCAGTCTGGTCTATAAAGGGAGTTCCAGGACTGCCCGAGCTGTTACT
CAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009713	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97482	(Get FASTA)	NCBI Sequence Viewer
	AAV73775	(Get FASTA)	NCBI Sequence Viewer
	EDL77718	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001009713 ⟸ NM_001009713

- UniProtKB:

Q5Q0U0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRPLLRGPAGNDDEESSDSTPLLPSARQIEAAPACCSARYNLALLAFCGFFVLYALRVNLSVAL
VDMVDSNSTLTDNRTSKECAEHSAPVKVHHNHTGKKYQWDAETQGWILGSFFYGYIVTQIPGGY
MASRIGGKLLLGLGILGTAVFTLFTPLAADLGVVALIVLRALEGLGEGVTFPAMHAMWSSWAPP
LERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGLVGIVWFILWMWIVSDTPETHK
TISHYEKEYIVSSLKNQLSSQKVVPWVSILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEIL
RFNVQENGFLSALPYFGCWLCMIVCGQAADYLRVKWNFSTISVRRIFSLIGMVGPAVFLVAAGF
IGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMIGPIIAKSLT
PDNTIKEWQTVFCIAAAINVFGAIFFTLFAKGEVQNWALSDHHGHGN

hide sequence

RefSeq Acc Id:

ENSRNOP00000012474 ⟸ ENSRNOT00000012474

Protein Domains

MFS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5Q0U0-F1-model_v2	AlphaFold	Q5Q0U0	1-495	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696146

Promoter ID:

EPDNEW_R6671

Type:

multiple initiation site

Name:

Slc17a5_1

Description:

solute carrier family 17 member 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	85,926,427 - 85,926,487	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311388	AgrOrtholog
BioCyc Gene	G2FUF-29754	BioCyc
Ensembl Genes	ENSRNOG00000009330	Ensembl
Gene3D-CATH	1.20.1250.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7459136	IMAGE-MGC_LOAD
InterPro	Major_facilitator_SF	UniProtKB/TrEMBL
	MFS_1	UniProtKB/TrEMBL
	MFS_trans_sf	UniProtKB/TrEMBL
KEGG Report	rno:363103	UniProtKB/TrEMBL
MGC_CLONE	MGC:114551	IMAGE-MGC_LOAD
NCBI Gene	363103	ENTREZGENE
Pfam	MFS_1	UniProtKB/TrEMBL
PhenoGen	Slc17a5	PhenoGen
PROSITE	MFS	UniProtKB/TrEMBL
Superfamily-SCOP	MFS_gen_substrate_transporter	UniProtKB/TrEMBL
UniProt	Q5Q0U0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-09	Slc17a5	solute carrier family 17 member 5	Slc17a5	solute carrier family 17 (acidic sugar transporter), member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Slc17a5	solute carrier family 17 (acidic sugar transporter), member 5	Slc17a5	solute carrier family 17 (anion/sugar transporter), member 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Slc17a5	solute carrier family 17 (anion/sugar transporter), member 5	Slc17a5_predicted	solute carrier family 17 (anion/sugar transporter), member 5 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Slc17a5_predicted	solute carrier family 17 (anion/sugar transporter), member 5 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB