Advanced Search (OLGA)

Gene: Frzb (frizzled-related protein) Rattus norvegicus

Analyze

Symbol:

Frzb

Name:

frizzled-related protein

RGD ID:

1311315

Description:

Predicted to enable Wnt-protein binding activity. Predicted to be involved in several processes, including negative regulation of cell growth; neural crest cell differentiation; and somite development. Predicted to act upstream of or within several processes, including cochlea morphogenesis; negative regulation of canonical Wnt signaling pathway; and negative regulation of cell differentiation. Predicted to be located in extracellular region. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma and osteoarthritis. Orthologous to human FRZB (frizzled related protein); PARTICIPATES IN Wnt signaling, canonical pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC295691; secreted frizzled-related protein 3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FRZB (frizzled related protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Frzb (frizzled-related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Frzb (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FRZB (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FRZB (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Frzb (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FRZB (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FRZB (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Frzb (frizzled related protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PHACTR1 (phosphatase and actin regulator 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	FRZB (frizzled related protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Frzb (frizzled-related protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	frzb (frizzled related protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	frzb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,739,162 - 85,772,168 (-)	NCBI		GRCr8
mRatBN7.2	3	65,332,274 - 65,365,208 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	65,332,277 - 65,365,208 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	68,678,473 - 68,711,328 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	77,262,043 - 77,294,902 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	75,024,919 - 75,057,671 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	67,635,604 - 67,668,772 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	67,635,607 - 67,668,772 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	74,196,163 - 74,229,331 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	63,350,504 - 63,383,436 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	63,246,875 - 63,295,070 (-)	NCBI
Celera	3	64,780,097 - 64,813,027 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

lung adenocarcinoma (ISO)

lung non-small cell carcinoma (ISO)

lung squamous cell carcinoma (ISO)

osteoarthritis (ISO)

Osteoarthritis, Hip (ISO)

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (EXP,ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzylpenicillin (ISO)

beta-naphthoflavone (EXP,ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

chlorohydrocarbon (EXP)

choline (ISO)

cisplatin (ISO)

clobetasol (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cytarabine (ISO)

deguelin (ISO)

dexamethasone (ISO)

diallyl trisulfide (EXP)

diethylstilbestrol (ISO)

dioxygen (ISO)

diquat (ISO)

dorsomorphin (ISO)

doxorubicin (EXP)

endosulfan (EXP)

ethanol (ISO)

folic acid (ISO)

furan (EXP)

genistein (ISO)

glycidol (EXP)

GW 4064 (ISO)

ibuprofen (ISO)

indometacin (ISO)

L-methionine (ISO)

lead(0) (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methoxychlor (EXP)

methylmercury chloride (EXP,ISO)

Monobutylphthalate (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel subsulfide (EXP)

niclosamide (ISO)

Nutlin-3 (ISO)

ochratoxin A (EXP,ISO)

oxybenzone (EXP)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorohexanesulfonic acid (ISO)

phenylmercury acetate (ISO)

pioglitazone (ISO)

progesterone (ISO)

propanal (ISO)

quercetin (ISO)

retinyl acetate (ISO)

rofecoxib (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloroethene (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cell differentiation (IEA)

cochlea morphogenesis (IEA,ISO)

convergent extension involved in organogenesis (IEA,ISO)

developmental process (IEA)

epithelial cell development (IEA,ISO)

hepatocyte differentiation (IEA,ISO)

inner ear morphogenesis (IEA,ISO)

negative regulation of canonical Wnt signaling pathway (IEA,ISO)

negative regulation of cartilage development (IEA,ISO)

negative regulation of cell development (IEA,ISO)

negative regulation of cell growth (IEA,ISO)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of hepatocyte differentiation (IEA,ISO)

negative regulation of Wnt signaling pathway (IEA,ISO)

neural crest cell differentiation (IEA,ISO)

positive regulation of apoptotic process (IEA,ISO)

positive regulation of fat cell differentiation (IEA,ISO)

somite development (IEA,ISO)

Wnt signaling pathway (IEA)

Cellular Component

extracellular region (IEA)

Molecular Function

protein binding (ISO)

Wnt-protein binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Wnt signaling, canonical pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Secreted and transmembrane wnt inhibitors and activators.	Cruciat CM and Niehrs C, Cold Spring Harb Perspect Biol. 2013 Mar 1;5(3):a015081. doi: 10.1101/cshperspect.a015081.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	Reduced skeletal muscle secreted frizzled-related protein 3 is associated with inflammation and insulin resistance.	Pachori AS, etal., Obesity (Silver Spring). 2017 Apr;25(4):697-703. doi: 10.1002/oby.21787. Epub 2017 Feb 27.
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Comprehensive gene review and curation	RGD comprehensive gene curation
10.	Epigenetic loss of putative tumor suppressor SFRP3 correlates with poor prognosis of lung adenocarcinoma patients.	Schlensog M, etal., Epigenetics. 2018;13(3):214-227. doi: 10.1080/15592294.2016.1229730. Epub 2018 Apr 18.

Additional References at PubMed

PMID:9178261	PMID:10654605	PMID:12055200	PMID:12477932	PMID:17433286	PMID:17462603	PMID:17471511	PMID:18166153	PMID:18991062	PMID:19562671	PMID:19961844	PMID:20208569
PMID:20551380	PMID:24006456	PMID:25046226

Genomics

Comparative Map Data

Frzb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	85,739,162 - 85,772,168 (-)	NCBI		GRCr8
mRatBN7.2	3	65,332,274 - 65,365,208 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	65,332,277 - 65,365,208 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	68,678,473 - 68,711,328 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	77,262,043 - 77,294,902 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	75,024,919 - 75,057,671 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	67,635,604 - 67,668,772 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	67,635,607 - 67,668,772 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	74,196,163 - 74,229,331 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	63,350,504 - 63,383,436 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	63,246,875 - 63,295,070 (-)	NCBI
Celera	3	64,780,097 - 64,813,027 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

FRZB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	182,833,275 - 182,866,637 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	182,833,275 - 182,866,637 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	183,698,002 - 183,731,365 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	183,406,982 - 183,439,743 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	183,524,242 - 183,557,004	NCBI
Celera	2	177,294,242 - 177,327,734 (-)	NCBI		Celera
Cytogenetic Map	2	q32.1	NCBI
HuRef	2	175,555,371 - 175,588,842 (-)	NCBI		HuRef
CHM1_1	2	183,703,943 - 183,737,410 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	183,322,235 - 183,355,596 (-)	NCBI		T2T-CHM13v2.0

Frzb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	80,242,314 - 80,277,740 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	80,242,314 - 80,277,969 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	80,411,970 - 80,447,396 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	80,411,970 - 80,447,625 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	80,252,127 - 80,287,553 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	80,212,809 - 80,248,235 (-)	NCBI		MGSCv36	mm8
Celera	2	82,075,833 - 82,112,383 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	48.13	NCBI

Frzb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	14,598,765 - 14,631,154 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	14,598,765 - 14,627,997 (+)	NCBI	ChiLan1.0	ChiLan1.0

FRZB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	85,492,596 - 85,525,895 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	85,507,574 - 85,540,875 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	70,106,378 - 70,139,333 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	187,915,579 - 187,948,855 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	187,915,579 - 187,948,855 (-)	Ensembl	panpan1.1		panPan2

FRZB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	25,884,557 - 25,907,436 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	25,884,557 - 25,907,369 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	25,782,614 - 25,812,978 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	26,038,918 - 26,069,318 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	26,039,164 - 26,076,017 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	26,165,036 - 26,195,383 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	26,095,997 - 26,126,346 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	26,237,636 - 26,268,037 (-)	NCBI		UU_Cfam_GSD_1.0

Frzb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	142,886,744 - 142,917,194 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	11,440,148 - 11,470,967 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	11,440,414 - 11,471,042 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FRZB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	88,332,860 - 88,377,247 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	88,332,856 - 88,377,275 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	97,838,143 - 97,881,633 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FRZB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	68,353,393 - 68,385,135 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	68,351,922 - 68,385,110 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	131,158,267 - 131,189,920 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Frzb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624844	4,608,016 - 4,643,141 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624844	4,608,016 - 4,639,582 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Frzb
212 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	132
Interacting mature miRNAs:	161
Transcripts:	ENSRNOT00000010247
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Markers in Region

RH132687

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	65,332,994 - 65,333,174 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	67,636,325 - 67,636,504	NCBI	Rnor6.0
Rnor_5.0	3	74,196,884 - 74,197,063	UniSTS	Rnor5.0
RGSC_v3.4	3	63,351,225 - 63,351,404	UniSTS	RGSC3.4
Celera	3	64,780,818 - 64,780,997	UniSTS
Cytogenetic Map	3	q24	UniSTS

RH134537

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	65,332,365 - 65,332,553 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	67,635,696 - 67,635,883	NCBI	Rnor6.0
Rnor_5.0	3	74,196,255 - 74,196,442	UniSTS	Rnor5.0
RGSC_v3.4	3	63,350,596 - 63,350,783	UniSTS	RGSC3.4
Celera	3	64,780,189 - 64,780,376	UniSTS
Cytogenetic Map	3	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	57	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001100527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063283281	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC098777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010247 ⟹ ENSRNOP00000010247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	65,332,277 - 65,365,208 (-)	Ensembl
Rnor_6.0 Ensembl	3	67,635,607 - 67,668,772 (-)	Ensembl

RefSeq Acc Id:

NM_001100527 ⟹ NP_001093997

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,739,162 - 85,772,096 (-)	NCBI
mRatBN7.2	3	65,332,274 - 65,365,208 (-)	NCBI
Rnor_6.0	3	67,635,604 - 67,668,772 (-)	NCBI
Rnor_5.0	3	74,196,163 - 74,229,331 (-)	NCBI
RGSC_v3.4	3	63,350,504 - 63,383,436 (-)	RGD
Celera	3	64,780,097 - 64,813,027 (-)	RGD

Sequence:

show sequence

GTCATTAACTCTCGCTGGATAGGGCCCTGCCATTGCTCTCAAGAGGCTGTGGTGTCTGCGACGT
AGACATTTAAAGTGACTTTGCTCCAGCCTCCCAGCCCGACTTTCTGCAGGCGGAGGCTGATGTC
TCTGCCAGAGCGAGAGGAATAAATAGATGCTGCCTCGTCTAGAGGCTTAGACTCTCGGGAAGAG
CAGCCAGCGGAGCAAGGCACCGAGCTCCGCCAGGCTCCTGGACCGGACCTGGGAGGACTTGGAT
CCAAGAGTACTGTGGTTGTCCCGGGGAACGGCTGTTCACCCCTCCGGACCGCAGGAGGAGAATC
CAGAACGCGCCTCTCCGGTCCATCGCCCGGCTGCGCCCTGCCCCATCCATCCTGCTGGGACCAT
GGTCTGCCGCGGCCCGGGACGGATGCTGCTAGGATGGGCCGGGCTGTTGGTCCTGGCTGCTCTC
TGCCTGCTCCAGGTACCCGGAGCCCAGGCAGCAGCCTGCGAGCCTGTCCGCATCCCCCTGTGCA
AGTCCCTACCCTGGAACATGACCAAGATGCCCAACCACCTGCACCACAGTACCCAGGCTAACGC
CATCCTGGCCATCGAACAATTCGAAGGGCTGCTGGGCACCCACTGCAGCCCGGATCTTCTCTTC
TTCCTCTGTGCCATGTACGCACCCATTTGCACCATCGACTTCCAGCACGAGCCCATCAAGCCCT
GCAAGTCCGTGTGTGAGCGCGCCCGACAGGGCTGCGAGCCCATCCTCATCAAGTACCGCCACTC
GTGGCCGGAAAGCTTGGCCTGCGAAGAGCTGCCGGTGTACGACCGCGGCGTGTGCATCTCTCCG
GAGGCCATCGTCACCGCGGACGGAGCCGATTTTCCTATGGATTCGAGCACTGGACACTGCAGAG
GGACAAGCAGTGAACGTTGCAAATGTAAGCCTGTCAGAGCTACACAGAAGACCTATTTCCGGAA
CAATTACAACTATGTCATCCGGGCTAAAGTTAAAGAGGTAAAGATGAAATGTCATGACGTGACC
GCCATTGTGGAGGTGAAGGAAATTCTAAAGGCATCACTGGTAAACATTCCAAGGGATACCGTCA
ACCTGTACAGCACCTCTGGCTGCCTCTGCCCTCCCCTCAGTGTTAATGAGGAGTATGTCATCAT
GGGGTATGAAGATGAAGAGCGCTCCAGGTTACTCTTGGTAGAAGGCTCTATCGCTGAGAAGTGG
AAGGATCGGCTTGGTAAGAAAGTCAAGCGCTGGGATATGAAACTCCGTCATCTTGGACTGGGTA
AAACTGATGCCAGCGATTCCACTCAGAATCAGAAGTCTGGCAGGAACGCTAATCCCCGGCCAGC
GCGCAGCTGAATCCTGAAATGTAAAAGGCCACACCCACGGACTCCCTCCTAAGACTGGCGCTGC
TGGACTAGCAAAGGAACACCGCACGGTTGCACTCGCGACCTCCTGTTTACCACAGACACCGCGT
GCCAACTGATGTTACTTCTGGTTCCTTTTCTCCTGCTTCTTAATAGCCTGGGGTTAGATTCTTC
TATATGTTCTATATCCTGTTTCACCAACCATGTGGGAACTGTTCTTTTGCAACCAGAATAATAA
ATTAAATATGTTGATGCTAAGGTCTCTGTCCTGGAGTCCCGGGTTTTAATTTGGTGTTCTGTAC
CCCGATTGAGATGCAGTATTTGATGTAAAGAGAGAATTCTGGTAATATCTCAAGAACTAGATAT
TGCTGTAAAGCAGACTCTGCGGCTATCCTTGAAGCCTTGTGTTTGTATGCCTTTGGGCATTTCC
CTCATGCTGTGAAAGTTCTAAATGTTTATAAAGGTAGAATGGCAGATTGAAATCAGACACTGCA
CAAGCGGAGCGGGGCAACACCGGGAAGCATTTATGAGGAAATGCCACACAGCATGAATTATTTT
CAAGATTGGCAGGCAGCAAAATAAATAGTGTTAGGAGCCAAGAAAAGAATATTTTGCCTGGTTA
AGGGGCACACTGGAGTCAGTAGCCCTTGAGCCACTGACAACAGTGCTCTTCTGGCAAAGTCTTT
TGATTTGTTCATAAATGTATTAACGGACATTAGAGAAAAGCTTATAGCTAGACTTCTGTTGTTA
TCACTGTAGCTCTGCTTCCTTCTAAATAAAGCTCATTGTTGGACGCCCCACCTCCATTCAGAAA
TAAATTTGGCTCGCTGTATTGACCAGGAAAAGAAAGCACTGAAGTATGCATGTGTGCACCAGGG
TGTTATTTTAAAGAGATGTGTAACTCTATAAAAGACTATAGTTTACAGGACAGTGAAATGTGCA
CATTTGTTTTCTTTTTTATTCTTCTTTTTGCTTTGGGCTTGTGATTTTGGTTTTTGGTGTGTCT
GTATTTTTGGGGGTGGGTGGTTTAAGCCATTGCACATCCAAGTCGAACTAGATGAGTAGACTAG
GCTCATGGCCTAGACCTTATGAATTGAATTTGTGCTGTTTAATGCTCCGTCAAAATGTCTAATA
AAAGGAATTATGGTTGTCGGGAGAGACAACAACAACAAAAATGTTTTTCTTACTCAAGCTGCAG
TGAAACCCCCGATGGCCCATGGGGAACTCATGGTGCCTTTTCTTCCTTCCTGCAGTGGGGATCT
TTAGAGCATGTGCCAATCACCTAAAAGTCTCATTCCTTGCAGCTTACGCATGTGGTAGTAGTGG
ATCCAAATTCCTAAGCTATGGTGTGCTGAAAATAAAGCATGTATGAAGCAAAAAAAAAAAAAAA
AAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063283281 ⟹ XP_063139351

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	85,739,162 - 85,772,168 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001093997	(Get FASTA)	NCBI Sequence Viewer
	XP_063139351	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98777	(Get FASTA)	NCBI Sequence Viewer
	AAI66428	(Get FASTA)	NCBI Sequence Viewer
	EDL79280	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010247
	ENSRNOP00000010247.5

RefSeq Acc Id:	NP_001093997 ⟸ NM_001100527
- Peptide Label:	precursor
- UniProtKB:	B2GUW1 (UniProtKB/TrEMBL), A6HMM9 (UniProtKB/TrEMBL), F7F8N4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MVCRGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQAN AILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRH SWPESLACEELPVYDRGVCISPEAIVTADGADFPMDSSTGHCRGTSSERCKCKPVRATQKTYFR NNYNYVIRAKVKEVKMKCHDVTAIVEVKEILKASLVNIPRDTVNLYSTSGCLCPPLSVNEEYVI MGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNANPRP ARS hide sequence

Ensembl Acc Id:

ENSRNOP00000010247 ⟸ ENSRNOT00000010247

RefSeq Acc Id:	XP_063139351 ⟸ XM_063283281
- Peptide Label:	isoform X1
- UniProtKB:	A6HMM9 (UniProtKB/TrEMBL), B2GUW1 (UniProtKB/TrEMBL), F7F8N4 (UniProtKB/TrEMBL)

Protein Domains

FZ NTR

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GUW1-F1-model_v2	AlphaFold	B2GUW1	1-323	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692171

Promoter ID:

EPDNEW_R2695

Type:

single initiation site

Name:

Frzb_1

Description:

frizzled-related protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	67,667,987 - 67,668,047	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311315	AgrOrtholog
BioCyc Gene	G2FUF-49225	BioCyc
Ensembl Genes	ENSRNOG00000007765	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010247	ENTREZGENE
	ENSRNOT00000010247.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.2000.10	UniProtKB/TrEMBL
	2.40.50.120	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7106784	IMAGE-MGC_LOAD
	IMAGE:7374231	IMAGE-MGC_LOAD
InterPro	Frizzled_dom	UniProtKB/TrEMBL
	Frizzled_dom_sf	UniProtKB/TrEMBL
	Frizzled_related	UniProtKB/TrEMBL
	Netrin_domain	UniProtKB/TrEMBL
	Netrin_module_non-TIMP	UniProtKB/TrEMBL
	NTR_Sfrp3	UniProtKB/TrEMBL
	SFRP3_CRD	UniProtKB/TrEMBL
	TIMP-like_OB-fold	UniProtKB/TrEMBL
KEGG Report	rno:295691	UniProtKB/TrEMBL
MGC_CLONE	MGC:112808	IMAGE-MGC_LOAD
	MGC:187419	IMAGE-MGC_LOAD
NCBI Gene	295691	ENTREZGENE
PANTHER	Fz_related	UniProtKB/TrEMBL
	PTHR11309:SF97	UniProtKB/TrEMBL
Pfam	NTR	UniProtKB/TrEMBL
	PF01392	UniProtKB/TrEMBL
PhenoGen	Frzb	PhenoGen
PROSITE	NTR	UniProtKB/TrEMBL
	PS50038	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007765	RatGTEx
SMART	C345C	UniProtKB/TrEMBL
	FRI	UniProtKB/TrEMBL
Superfamily-SCOP	Frizzled_Cys-rich	UniProtKB/TrEMBL
	TIMP_like	UniProtKB/TrEMBL
UniProt	A6HMM9	ENTREZGENE, UniProtKB/TrEMBL
	B2GUW1	ENTREZGENE
	F7F8N4	ENTREZGENE, UniProtKB/TrEMBL
	Q4G040_RAT	UniProtKB/TrEMBL
UniProt Secondary	B2GUW1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Frzb	frizzled-related protein	Frzb_predicted	frizzled-related protein (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Frzb_predicted	frizzled-related protein (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations