Abhd1 (abhydrolase domain containing 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Abhd1 (abhydrolase domain containing 1) Rattus norvegicus

Analyze

Symbol:

Abhd1

Name:

abhydrolase domain containing 1

RGD ID:

1310988

Description:

Predicted to enable acetylesterase activity and acylglycerol lipase activity. Predicted to be involved in medium-chain fatty acid biosynthetic process and medium-chain fatty acid catabolic process. Predicted to be located in membrane. Orthologous to human ABHD1 (abhydrolase domain containing 1); INTERACTS WITH (+)-schisandrin B; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

abhydrolase domain-containing protein 1; alpha/beta hydrolase domain containing protein 1; alpha/beta hydrolase domain-containing protein 1; LOC313917; MGC105659

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ABHD1 (abhydrolase domain containing 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Abhd1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Abhd1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ABHD1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ABHD1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Abhd1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ABHD1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ABHD1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Abhd1 (abhydrolase domain containing 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ABHD3 (abhydrolase domain containing 3, phospholipase)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	ABHD1 (abhydrolase domain containing 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Abhd1 (abhydrolase domain containing 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	EEB1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	EHT1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Hydr1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MGL2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	abhd-3.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	abhd-3.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	25,422,526 - 25,427,514 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	25,422,526 - 25,427,514 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	25,722,841 - 25,727,828 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	26,038,705 - 26,043,692 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	25,517,888 - 25,522,871 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	26,787,807 - 26,792,795 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,784,058 - 26,792,808 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,603,422 - 36,608,410 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,405,493 - 25,410,481 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	25,408,445 - 25,413,434 (-)	NCBI
Celera	6	24,913,248 - 24,918,236 (-)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Tatton-Brown-Rahman syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (EXP,ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP)

arsenous acid (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

cocaine (ISO)

Cuprizon (EXP)

dexamethasone (EXP)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

flutamide (EXP)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

glafenine (EXP)

kojic acid (ISO)

L-ethionine (EXP)

leflunomide (EXP)

levofloxacin (EXP)

methotrexate (ISO)

Muraglitazar (EXP)

N-nitrosodiethylamine (ISO)

nefazodone (EXP)

omeprazole (EXP)

p-toluidine (EXP)

paracetamol (EXP)

parathion (ISO)

PCB138 (ISO)

perfluorooctanoic acid (EXP)

permethrin (ISO)

phenobarbital (ISO)

pirinixic acid (EXP,ISO)

resveratrol (ISO)

rotenone (EXP)

silicon dioxide (ISO)

sunitinib (ISO)

Tesaglitazar (EXP)

testosterone (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

medium-chain fatty acid biosynthetic process (IBA)

medium-chain fatty acid catabolic process (IBA)

Cellular Component

membrane (IEA)

Molecular Function

acetylesterase activity (IBA)

acylglycerol lipase activity (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:12477932	PMID:15489334

Genomics

Comparative Map Data

Abhd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	25,422,526 - 25,427,514 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	25,422,526 - 25,427,514 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	25,722,841 - 25,727,828 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	26,038,705 - 26,043,692 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	25,517,888 - 25,522,871 (-)	NCBI	Rnor_WKY
Rnor_6.0	6	26,787,807 - 26,792,795 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,784,058 - 26,792,808 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,603,422 - 36,608,410 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,405,493 - 25,410,481 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	25,408,445 - 25,413,434 (-)	NCBI
Celera	6	24,913,248 - 24,918,236 (-)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

ABHD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	27,123,815 - 27,130,812 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	27,123,789 - 27,130,812 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	27,346,683 - 27,353,680 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	27,200,161 - 27,207,184 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	27,258,307 - 27,265,329	NCBI
Celera	2	27,192,963 - 27,199,985 (+)	NCBI		Celera
Cytogenetic Map	2	p23.3	NCBI
HuRef	2	27,088,820 - 27,095,530 (+)	NCBI		HuRef
CHM1_1	2	27,276,604 - 27,283,604 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	27,165,161 - 27,172,457 (+)	NCBI		T2T-CHM13v2.0

Abhd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	31,107,410 - 31,112,439 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	31,107,410 - 31,112,435 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	30,950,066 - 30,955,095 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	30,950,066 - 30,955,091 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	31,252,439 - 31,257,468 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	31,226,653 - 31,231,672 (+)	NCBI		MGSCv36	mm8
Celera	5	28,429,859 - 28,434,894 (+)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI

Abhd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	9,092,051 - 9,100,652 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	9,092,074 - 9,097,635 (+)	NCBI	ChiLan1.0	ChiLan1.0

ABHD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	99,388,722 - 99,395,935 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	27,122,572 - 27,129,787 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	27,211,963 - 27,219,013 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	27,211,963 - 27,219,013 (+)	Ensembl	panpan1.1		panPan2

ABHD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	21,105,686 - 21,116,467 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	21,110,808 - 21,116,465 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	20,997,511 - 21,008,292 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	21,426,382 - 21,437,174 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	21,431,513 - 21,437,172 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	21,113,115 - 21,123,897 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	21,124,236 - 21,135,008 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	21,171,072 - 21,181,857 (+)	NCBI		UU_Cfam_GSD_1.0

Abhd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	65,410,365 - 65,419,473 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	5,420,158 - 5,429,682 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936493	5,420,091 - 5,429,304 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ABHD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	111,996,142 - 112,002,132 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	111,996,138 - 112,002,127 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	118,994,624 - 119,000,603 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ABHD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	80,488,851 - 80,495,723 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	80,489,099 - 80,494,592 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	31,644,632 - 31,650,179 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Abhd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	9,223,807 - 9,233,737 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	9,223,949 - 9,229,336 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Abhd1
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	31
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000010403
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
1359023	Bp272	Blood pressure QTL 272	2.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	16536140	27261739	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat

Markers in Region

RH136976

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	25,422,403 - 25,422,554 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,787,685 - 26,787,835	NCBI	Rnor6.0
Rnor_5.0	6	36,603,300 - 36,603,450	UniSTS	Rnor5.0
RGSC_v3.4	6	25,405,371 - 25,405,521	UniSTS	RGSC3.4
Celera	6	24,913,126 - 24,913,276	UniSTS
RH 3.4 Map	6	92.7	UniSTS
Cytogenetic Map	6	q14	UniSTS

BQ198731

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	25,425,964 - 25,426,167 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	26,791,246 - 26,791,448	NCBI	Rnor6.0
Rnor_5.0	6	36,606,861 - 36,607,063	UniSTS	Rnor5.0
RGSC_v3.4	6	25,408,932 - 25,409,134	UniSTS	RGSC3.4
Celera	6	24,916,687 - 24,916,889	UniSTS
RH 3.4 Map	6	120.08	UniSTS
Cytogenetic Map	6	q14	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			3	3		3			1	3
Low	3	43	54	38	19	38	8	11	73	32	41	11	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008520	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000010403 ⟹ ENSRNOP00000009339

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	25,422,526 - 25,427,514 (-)	Ensembl
Rnor_6.0 Ensembl	6	26,784,058 - 26,792,808 (-)	Ensembl

RefSeq Acc Id:

NM_001008520 ⟹ NP_001008520

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	25,422,526 - 25,427,514 (-)	NCBI
Rnor_6.0	6	26,787,807 - 26,792,795 (-)	NCBI
Rnor_5.0	6	36,603,422 - 36,608,410 (-)	NCBI
RGSC_v3.4	6	25,405,493 - 25,410,481 (-)	RGD
Celera	6	24,913,248 - 24,918,236 (-)	RGD

Sequence:

show sequence

GTCAAAGTTCAGGAGCTGGAGGAGCCGGGAGCCTGGGAAATGGAATACCTCCACATAACCAAGA
TGCTGAGTTCCTCTCTGAGCCCGCAAAATGGCACCTGGTCAGATGCCATCTCTCTGCTCTTAGC
TCTTGGCATTGCTCTCTACTTGGGCTACTACTGGGCATGTGTGCCCCAGAGGCCTCGTCTGGTG
GCTGGGCCCCAGTTTCTGGCCTTCCTGGAGCAACACTGTCCAGTCACTGTGGAGACTTTCTACC
CCACACTATGGTGCTTTGAGGGACGGCTGCAAACCATCTTTCGAGTCCTCCTGCAGTCTCAGCC
TGTGATCCCTTACCGGAGTGAAGTCCTCCAGACCCCGGATGGAGGCCAGTTCCTTCTGGACTGG
GCTGAGCAGCCTTACAGCAGTCACTGCCCAGACCCGACCACCCAGCCCATAGTACTATTGCTTC
CGGGTATCAGCGGCAGCAGCCAGGAGCCATATATCTTACACCTAGTTGACCAGGCTCTGAAGGA
TGGCTATAGGGCTGTTGTATTTAATAACCGTGGATGCCGAGGGGAAGAGCTGCTGACGCACAGG
GCTTACTGTGCCAGCAACACTGAAGACCTAGAAACGGTTGTGAAGCACATAAAGCACCGCTACT
CCCGAGCTCCACTGCTGGCTGTGGGGATCTCTTTCGGAGGGATACTGGTACTTAACTACCTGGC
ACGGACCGGGAAGGCTGGAGGCTTGGTCGCGGGACTGACCATGTCTGCGTGTTGGGATTCCTTT
GAGACCGTTGACTCCTTGGAGACCCCACTCAACTCACTGCTCTTCAACCAGCCCCTCACTGCTG
GACTCTGCCGGCTTGTGGCCAGGAACAGAAAGTCAATTGAAAAGGTGTTGGATGTAGACTTTGC
GATAAAGGCCCGCACAATCCGCCAGCTGGATGAGCGCTACACATCTGTGGCTTTTGGGTATAAA
GACTGTGCGGCTTATTACCATGCCTCAAGCCCGAGAACCAAGGTGGATGCCATCTGCACCCCTG
TCCTCTGCCTCAATGCAGCAGACGATCCCTTCTCCCCAGTGCAGGCCCTCCCTCTGCAGGCTGC
CCAGAAGTCTCCCTACGTGGCCCTGCTCATCACAGCTCGGGGTGGCCACATTGGCTTCCTGGAA
GGGCTGCTGCCCTGGCAACACTGTTACATGAACCGCGTGCTACATCAGTATGCCCGAGCTGTCT
TCCAGCACTCGGTGGGGCTGCCGGGCCTCGGAGCACTCACTCCTGAAGATGGAAAGAGCTGACC
AGAGGACTGCTGGGGTCTCGGTTCAATCTTTCTTTCTTTATTAAATATCAACTCTTCCTGCCTA
ATAAACTGAGGTTCACTTTCAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039112176 ⟹ XP_038968104

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	25,422,526 - 25,424,273 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008520	(Get FASTA)	NCBI Sequence Viewer
	XP_038968104	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86351	(Get FASTA)	NCBI Sequence Viewer
	EDM02958	(Get FASTA)	NCBI Sequence Viewer
	EDM02959	(Get FASTA)	NCBI Sequence Viewer
	Q5RK23	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001008520 ⟸ NM_001008520

- UniProtKB:

Q5RK23 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEYLHITKMLSSSLSPQNGTWSDAISLLLALGIALYLGYYWACVPQRPRLVAGPQFLAFLEQHC
PVTVETFYPTLWCFEGRLQTIFRVLLQSQPVIPYRSEVLQTPDGGQFLLDWAEQPYSSHCPDPT
TQPIVLLLPGISGSSQEPYILHLVDQALKDGYRAVVFNNRGCRGEELLTHRAYCASNTEDLETV
VKHIKHRYSRAPLLAVGISFGGILVLNYLARTGKAGGLVAGLTMSACWDSFETVDSLETPLNSL
LFNQPLTAGLCRLVARNRKSIEKVLDVDFAIKARTIRQLDERYTSVAFGYKDCAAYYHASSPRT
KVDAICTPVLCLNAADDPFSPVQALPLQAAQKSPYVALLITARGGHIGFLEGLLPWQHCYMNRV
LHQYARAVFQHSVGLPGLGALTPEDGKS

hide sequence

RefSeq Acc Id:

ENSRNOP00000009339 ⟸ ENSRNOT00000010403

RefSeq Acc Id:	XP_038968104 ⟸ XM_039112176
- Peptide Label:	isoform X1

Protein Domains

AB hydrolase-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RK23-F1-model_v2	AlphaFold	Q5RK23	1-412	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694451

Promoter ID:

EPDNEW_R4975

Type:

initiation region

Name:

Abhd1_1

Description:

abhydrolase domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	26,792,792 - 26,792,852	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310988	AgrOrtholog
BioCyc Gene	G2FUF-38336	BioCyc
Ensembl Genes	ENSRNOG00000025689	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000009339	ENTREZGENE
	ENSRNOP00000009339.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010403	ENTREZGENE
	ENSRNOT00000010403.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7302778	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot
	AB_hydrolase_1	UniProtKB/Swiss-Prot
	ABHD4	UniProtKB/Swiss-Prot
KEGG Report	rno:313917	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105659	IMAGE-MGC_LOAD
NCBI Gene	313917	ENTREZGENE
PANTHER	ABHYDROLASE DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot
	PROTEIN ABHD1	UniProtKB/Swiss-Prot
Pfam	Abhydrolase_1	UniProtKB/Swiss-Prot
PhenoGen	Abhd1	PhenoGen
PIRSF	Ab_hydro_YheT	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot
UniProt	ABHD1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Abhd1	abhydrolase domain containing 1	Abhd1_predicted	abhydrolase domain containing 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Abhd1_predicted	abhydrolase domain containing 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar